Anticuerpos primarios

<p>PHACTR1 antibody was raised using the middle region of PHACTR1 corresponding to a region with amino acids QRPTAEELEQRNILKPRNEQEEQEEKREIKRRLTRKLSQRPTVEELRERK</p>

<p>The HOXA1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to HOXA1, a protein involved in various cellular processes. This antibody has been extensively tested and proven to be nephrotoxic, making it an ideal tool for studying kidney-related diseases and functions.</p>

<p>C2ORF55 antibody was raised using the middle region of C2Orf55 corresponding to a region with amino acids ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF</p>

<p>Purified Rabbit polyclonal OR5U1 antibody</p>

<p>The RECQL4 antibody is a highly specialized monoclonal antibody that targets the RECQL4 protein. This protein plays a crucial role in DNA repair and maintenance, making it an essential component of cellular health. The RECQL4 antibody specifically recognizes and binds to the RECQL4 protein, activating its function and promoting efficient DNA repair processes.</p>

<p>The FKBP52 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to FKBP52, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies, histidine residues, alkaline phosphatases, epidermal growth factor (EGF), transforming growth factor-beta1 (TGF-beta1), and other growth factors.</p>

<p>Rabbit polyclonal SCRN2 antibody</p>

<p>Mouse monoclonal CD24 antibody (PE)</p>

<p>RPS6KB1 antibody was raised using the N terminal of RPS6KB1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL</p>

<p>Rabbit polyclonal SFTPA1 antibody</p>

<p>Rabbit polyclonal MPZ antibody (biotin)</p>

<p>Rabbit polyclonal ODZ1 antibody</p>

<p>CD20 antibody is a monoclonal antibody that specifically targets CD20, a protein found on the surface of B cells. This antibody is designed to neutralize CD20, preventing it from functioning properly. CD20 antibodies have been widely used in the field of Life Sciences for various applications. They can be used as research tools to study B cell function and development, as well as in diagnostic tests to identify and classify different types of B cell lymphomas.</p>

<p>CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS</p>

<p>Synthetic internal region human BCL10 immunogen; rabbit polyclonal BCL10 antibody</p>

<p>IL21R antibody was raised in Rabbit using Human IL21R as the immunogen</p>

<p>Rabbit polyclonal ALS2CR11 antibody</p>

<p>CETN1 antibody was raised in Rabbit using Human CETN1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal SNX18 antibody</p>

<p>FLCN antibody was raised in rabbit using the C terminal of FLCN as the immunogen</p>

<p>RNF20 antibody was raised using the middle region of RNF20 corresponding to a region with amino acids KEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEI</p>

<p>Rabbit polyclonal LKB1 antibody (Ser334)</p>

<p>Mouse monoclonal MAPK7 antibody</p>

<p>NSMCE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDE</p>

<p>Rabbit polyclonal GABARAPL1 antibody (FITC)</p>

<p>The CD8 antibody is a monoclonal antibody that belongs to the family of kinase inhibitors. It is widely used in Life Sciences for its cytotoxic properties. The CD8 antibody targets specific protein complexes and inhibits their function, leading to cell death through apoptosis. This monoclonal antibody has been shown to be effective against various diseases and conditions, including hepatic lipase activity, dopamine regulation, vasoactive intestinal peptide signaling, and necrosis factor-related apoptosis-inducing pathways. With its potent inhibitory effects, the CD8 antibody offers promising therapeutic potential in the field of molecular biology and immunology.</p>

<p>Mouse monoclonal SMAD5 antibody</p>

<p>The PAWR antibody is a highly specialized product in the field of Life Sciences. It is an antibody specifically designed for the detection and analysis of pluripotent stem cells. Pluripotent stem cells are unique cells with the ability to differentiate into any type of cell in the human body, making them extremely valuable for scientific research and medical applications.</p>

<p>The ELF5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying neurotrophic factors and their effects on progesterone concentration and steroid metabolism. This antibody is specifically designed to target and bind to ELF5, a transcription factor involved in the regulation of various angiogenic factors such as arginase, angptl3, TGF-beta, and growth factor-2.</p>

<p>Rabbit polyclonal RNF170 antibody</p>

<p>alpha Crystallin A antibody was raised in mouse using recombinant human Crystallin alpha A (1-173aa) purified from E. coli as the immunogen.</p>

<p>The SHC antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets tyrosine residues and plays a crucial role in signal transduction pathways. The SHC antibody is known to interact with various proteins, including TNF-related apoptosis-inducing ligand (TRAIL), protein kinases, phosphatases, and fibrinogen. This antibody has been extensively studied for its potential therapeutic applications, such as in the development of targeted cancer therapies. It has also been used in the study of angiogenesis and microvessel density, as well as growth factor signaling pathways. Researchers rely on the high specificity and sensitivity of the SHC antibody to gain insights into complex cellular processes and advance scientific understanding.</p>

<p>MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY</p>

<p>FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS</p>

<p>hnRNP L Monoclonal Antibody BSA/Azide Free</p>

<p>The ARP3 antibody is a highly specialized monoclonal antibody that targets extracellular histones. Histones play a crucial role in regulating gene expression through acetylation and other modifications. This antibody specifically binds to histones, inhibiting their activity and preventing them from interacting with other cellular components.</p>

<p>FEM1A antibody was raised in Rabbit using Human FEM1A as the immunogen</p>

<p>PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED</p>

<p>Mouse monoclonal GNA2132 antibody</p>

<p>TPH1 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the enzyme tryptophan hydroxylase 1 (TPH1), which is responsible for the conversion of tryptophan to serotonin in the brain and peripheral tissues. This antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. TPH1 antibody has been shown to have high specificity and sensitivity in detecting TPH1 protein expression in liver microsomes. It can also be used to study the role of TPH1 in various biological processes, such as neuronal development, mood regulation, and serotonin synthesis. Additionally, this antibody has been used in studies investigating the involvement of TPH1 in diseases like depression, anxiety disorders, and Parkinson's disease. With its wide range of applications and reliable performance, TPH1 antibody is an essential tool for researchers studying serotonin metabolism and related pathways.</p>

<p>Mouse monoclonal RDH14 antibody</p>

<p>UCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK</p>

<p>Rabbit polyclonal AP2B1 antibody</p>

<p>Rabbit polyclonal PIP5K3 antibody</p>

<p>PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE</p>

<p>Staphylococcus aureus antibody (FITC) was raised in rabbit using ATCC 27660 as the immunogen.</p>

<p>Cytokeratin 24 antibody was raised using the middle region of KRT24 corresponding to a region with amino acids GSVNMGSRDLVSGDSRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQV</p>

<p>The SERPINF2 antibody is a highly effective neutralizing agent that has been extensively studied in various scientific fields, including Life Sciences. It is a monoclonal antibody that has shown promising results in inhibiting the activity of SERPINF2, a protein involved in adipose tissue regulation. Through electrochemical impedance spectroscopy, it has been demonstrated that this antibody effectively binds to SERPINF2 and prevents its interaction with other molecules in the reaction solution.</p>

<p>Purified Polyclonal ARHGAP22 antibody</p>

<p>Rabbit polyclonal NDM1 antibody (HRP)</p>

<p>PSMD12 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR</p>

<p>Rabbit polyclonal PIB6 antibody</p>

<p>Factor XIII antibody (HRP) was raised in sheep using human Factor XIII purified from plasma as the immunogen.</p>

<p>MYLK3 antibody was raised in Rabbit using Human MYLK3 as the immunogen</p>

<p>KIAA0528 antibody was raised in Rabbit using Human KIAA0528 as the immunogen</p>

<p>CARS antibody was raised using the N terminal of CARS corresponding to a region with amino acids MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY</p>

<p>Rabbit polyclonal SNRPD2 antibody (HRP)</p>

<p>pLDH antibody is a monoclonal antibody that specifically targets the enzyme lactate dehydrogenase (LDH). LDH is found in various tissues, including adipose tissue and adipocytes. This antibody can be used for research purposes in the field of life sciences to study the expression and function of LDH in different cell types. The pLDH antibody recognizes a specific antigenic site on LDH and can be used to detect its presence in samples. It has been extensively validated for its specificity and sensitivity in various experimental settings. This antibody is commonly used in immunohistochemistry, western blotting, and ELISA assays. By targeting LDH, this antibody provides researchers with a valuable tool to investigate the role of this enzyme in cellular processes such as energy metabolism, glycolysis, and cancer development. Additionally, it can be used to study the effects of LDH inhibitors or other therapeutic interventions on cellular functions. With its high affinity and specificity, the pLDH antibody offers</p>

<p>IGF2 antibody was raised in rabbit using highly pure recombinant human IGF-II (human IGF-II) as the immunogen.</p>

<p>The TRPV6 antibody is a highly specialized biomolecule used in Life Sciences research. It is a monoclonal antibody that specifically targets the TRPV6 protein, which plays a crucial role in calcium transport across cell membranes. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal Histone H4 antibody (Ser47)</p>

<p>Affinity purified Rabbit polyclonal Wilms Tumor 1 antibody</p>

<p>The V5 antibody is a monoclonal antibody that targets hepatocyte growth. It is also known as an anti-HER2 antibody, and it belongs to the group of antibodies that inhibit the function of HER2 protein. The V5 antibody has been extensively studied in Life Sciences and has shown promising results in various applications. It has been found to bind to specific proteins such as collagen and fibronectin, thereby inhibiting their activity. Additionally, the V5 antibody has been shown to block the action of VEGF-C, which is a key factor in endothelial growth. This antibody can also interfere with signaling pathways involving epidermal growth factor and β-catenin. Overall, the V5 antibody offers a valuable tool for researchers studying hepatocyte growth and related processes.</p>

<p>ACAP2 antibody was raised in Rabbit using Human ACAP2 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections by inhibiting bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for treating respiratory disorders caused by bacteria such as Clostridium perfringens. By binding to the ribosomal subunit, Tilmicosin effectively inhibits bacterial growth. Studies have shown that Tilmicos</p>

<p>Mouse monoclonal MAPK7 antibody</p>

<p>CTCF antibody was raised in Rat using Mouse CTCF-N-terminal fragment as the immunogen.</p>

<p>The GOT2 antibody is a highly specialized product in the field of Life Sciences. It is an endothelial growth factor that plays a crucial role in various biological processes. This antibody is specifically designed to target and bind to the GOT2 antigen, which is involved in cell growth and proliferation.</p>

<p>Mouse monoclonal MHC Class II antibody (PE)</p>

<p>The TK antibody is a monoclonal antibody that specifically binds to TK (Thymidine Kinase), a protein involved in DNA synthesis. It is commonly used in research and diagnostic applications to detect the presence of TK or to study its function. The TK antibody can be used in various immunoassays, such as ELISA or Western blotting, to accurately measure the levels of TK in samples. This antibody has high specificity and sensitivity, making it an ideal tool for researchers in the field of Life Sciences. Additionally, the TK antibody can also be used for therapeutic purposes, targeting specific receptors or antigens associated with diseases such as cancer. Its binding properties allow for precise targeting and potential treatment options. With its robust binding capabilities and wide range of applications, the TK antibody is an essential tool for scientists and clinicians alike.</p>

<p>CDH4 antibody was raised in Rabbit using Human CDH4 as the immunogen</p>

<p>Rabbit polyclonal COX5A antibody (FITC)</p>

<p>Rabbit polyclonal CDKA2 antibody</p>

<p>Mouse monoclonal SIL1 antibody</p>

<p>Purified Polyclonal PIAS3 antibody</p>

<p>SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK</p>

<p>The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.</p>

<p>EPB41 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQ</p>

<p>MLXIPL antibody was raised in Rabbit using Human MLXIPL as the immunogen</p>

<p>Rabbit polyclonal SH3GLB1 antibody</p>

<p>Involucrin antibody was raised using the N terminal of IVL corresponding to a region with amino acids AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE</p>

<p>Rabbit polyclonal FUCA2 antibody (HRP)</p>

<p>ANKMY2 antibody was raised in Rabbit using Human ANKMY2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal SMC1B antibody</p>

<p>The SAA1 Antibody is a monoclonal antibody that plays a crucial role in endothelial growth. This antibody specifically targets and binds to histidine, a nuclear protein involved in various biological processes. In the field of Life Sciences, it has been extensively studied for its potential as an anti-HER2 antibody-drug conjugate, particularly in combination with trastuzumab. The SAA1 Antibody has shown promising results in inhibiting the growth factor signaling pathway, including epidermal growth factor (EGF) and activated HER2 receptors. With its high specificity and affinity, this antibody holds great potential for targeted therapies in the treatment of various diseases related to abnormal growth factor signaling.</p>

<p>The PDCD4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein known as Programmed Cell Death 4 (PDCD4). This protein plays a crucial role in regulating various cellular processes, including cell growth, proliferation, and apoptosis.</p>

<p>BACE2 antibody was raised in Rabbit using Human BACE2 as the immunogen</p>

<p>GSDMB antibody was raised in Rabbit using Human GSDMB as the immunogen</p>

<p>Mouse monoclonal IRF2 antibody</p>

<p>The eEF2 antibody is a monoclonal antibody that targets and binds to the eukaryotic elongation factor 2 (eEF2). This antibody plays a crucial role in cholinergic and dopamine signaling pathways. It has been extensively used in research within the field of Life Sciences to study the function and regulation of eEF2.</p>

<p>Mouse monoclonal KDM3A antibody</p>

<p>The Histone H3 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets histone H3, a protein involved in the regulation of gene expression and chromatin structure. This antibody has been extensively validated for use in various applications, including immunohistochemistry, western blotting, and chromatin immunoprecipitation.</p>

<p>The CNN2 antibody is a highly specialized monoclonal antibody that targets the CNN2 protein. This protein is involved in various cellular processes, including glycosylation and mineralization. It plays a crucial role in human folate metabolism and growth factor signaling. The CNN2 antibody specifically binds to the collagen domain of the CNN2 protein, blocking its activity and preventing downstream effects.</p>

<p>The FZD8 antibody is a highly specialized antibody that targets the epidermal growth factor receptor. This antibody is designed to specifically bind to FZD8, a protein involved in the Wnt signaling pathway. By binding to FZD8, the antibody inhibits the activation of β-catenin and downstream signaling events, ultimately leading to a decrease in cell proliferation and growth.</p>

<p>HIV1 p24 antibody was raised in mouse using HIV1 p24 (native antigen) as the immunogen.</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>Rabbit polyclonal GATA2 antibody (Ser401)</p>

<p>IL9 antibody was raised in Rabbit using Human IL9 as the immunogen</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>The CD11b antibody is a highly specific monoclonal antibody that targets the CD11b protein. This protein is involved in various cellular processes, including cell adhesion and migration. The CD11b antibody has been extensively studied for its inhibitory effects on the 5-ht1a serotonin receptor, which plays a crucial role in neurotransmission.</p>