Anticuerpos primarios

<p>SLC25A45 antibody is a glycoprotein that belongs to the chemokine binding protein family. It plays a crucial role in various biological processes, including interferon signaling and hepatocyte growth regulation. This antibody is widely used in Life Sciences research for its ability to specifically bind to SLC25A45 and facilitate the detection and analysis of this protein. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The SLC25A45 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. Its high specificity and cytotoxic properties make it an essential tool for studying the function and expression of SLC25A45 in different cellular contexts.</p>

<p>The F3 antibody is a potent cytotoxic and inhibitory factor used in Life Sciences. It targets various proteins and molecules such as tyrosinase, insulin, collagen, and fibronectin. This antibody has been extensively studied for its ability to neutralize autoantibodies and anti-ACTH antibodies. The F3 antibody is highly specific and can be used in a wide range of applications including research, diagnostics, and therapeutics. Its unique properties make it an essential tool for studying protein-protein interactions, cell signaling pathways, and immune responses. With its high affinity and specificity, the F3 antibody offers researchers unparalleled accuracy and reliability in their experiments.</p>

<p>The EFNB2 antibody is a medicinal product that falls under the category of Life Sciences. It is an antibody that specifically targets and inhibits the activity of EFNB2 protein. This antibody is known as a polyclonal antibody, meaning it is derived from multiple sources and can recognize different epitopes on the target protein. The EFNB2 antibody has been extensively studied and proven to be effective in various research applications within the field of Life Sciences. Its high specificity and affinity make it a valuable tool for scientists and researchers working in this area. With its ability to selectively bind to EFNB2 protein, this antibody opens up new possibilities for understanding its role in biological processes and developing therapeutic interventions.</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>Rat monoclonal Flk 1 antibody (allophycocyanin)</p>

<p>The NRF2 antibody is a highly effective tool in the field of immunology and molecular biology. This antibody belongs to the class of polyclonal antibodies, which are produced by multiple B cell clones and have the ability to recognize different epitopes on the target protein. The NRF2 antibody specifically targets the nuclear factor erythroid 2-related factor 2 (NRF2), a transcription factor that plays a crucial role in cellular defense against oxidative stress.</p>

<p>The CYP19 antibody is a highly specialized antibody that targets the aromatase enzyme, also known as cytochrome P450 19A1. This enzyme plays a crucial role in the synthesis of estrogen, making it an important target in hormone-related diseases and conditions. The CYP19 antibody specifically binds to the aromatase enzyme, inhibiting its activity and preventing the conversion of androgens into estrogens. This can have significant therapeutic implications in the treatment of hormone-dependent cancers such as breast cancer. Additionally, the CYP19 antibody has been used in research settings to study the regulation of estrogen synthesis and its impact on various physiological processes. With its high specificity and affinity for the aromatase enzyme, the CYP19 antibody is a valuable tool for both clinical and scientific applications in the field of endocrinology and oncology.</p>

<p>LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen</p>

<p>FOXA1 antibody is a monoclonal antibody that specifically targets β-catenin, a protein involved in various cellular processes. This antibody acts as a family kinase inhibitor, blocking the activity of kinases that regulate β-catenin signaling. It is widely used in life sciences research to study the role of β-catenin in development, cancer, and other diseases.</p>

<p>NOSIP antibody was raised using the N terminal of NOSIP corresponding to a region with amino acids LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Studies have shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>KIF5A antibody was raised using the middle region of KIF5A corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH</p>

<p>NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR</p>

<p>Rabbit polyclonal TPPP antibody</p>

<p>Rabbit polyclonal SPTAN1 antibody</p>

<p>The IGF1R antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the insulin-like growth factor 1 receptor (IGF1R) and has been shown to have cytotoxic effects on various types of cancer cells. This antibody can neutralize the activity of IGF1R, which is a key regulator of cell growth and proliferation. Additionally, it has been found to inhibit the expression of alpha-fetoprotein, a marker associated with liver cancer. The IGF1R antibody can also be used as an anti-connexin agent, blocking gap junction-mediated intercellular communication. In addition to its role in cancer research, this antibody has applications in studying adipose tissue development, endothelial growth factors, and nuclear signaling pathways.</p>

<p>Rat monoclonal TER119 antibody (allophycocyanin)</p>

<p>DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL</p>

<p>PPM1M antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL</p>

<p>IL2 antibody was raised in rat using recombinant Mouse IL-2 as the immunogen.</p>

<p>Mouse monoclonal SNX9 antibody</p>

<p>The CMKLR1 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the alpha-fetoprotein, a protein associated with various diseases and conditions. This antibody can be used for a wide range of applications, including research, diagnostics, and therapeutics. It has been extensively tested and validated to ensure its high specificity and effectiveness.</p>

<p>The Osteopontin antibody is a highly effective monoclonal antibody that targets the protein osteopontin. It is specifically designed to bind to this protein and inhibit its activity. Osteopontin is involved in various biological processes, including cell adhesion, migration, and inflammation. By targeting osteopontin, this antibody can potentially have therapeutic applications in various diseases, including cancer and autoimmune disorders.</p>

<p>CALN1 antibody was raised in Rabbit using Human CALN1 as the immunogen</p>

<p>FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS</p>

<p>Rabbit polyclonal MEKKK4 antibody</p>

<p>Rabbit polyclonal PUB15 antibody</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM</p>

<p>MIP4 antibody was raised in rabbit using highly pure recombinant hMIP-4 as the immunogen.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Purified Rabbit polyclonal PLK1 antibody (Thr210)</p>

<p>Rabbit polyclonal UCKL1 antibody</p>

<p>RPS15A antibody was raised using the middle region of RPS15A corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH</p>

<p>RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE</p>

<p>Rabbit polyclonal Kinase E11 antibody</p>

<p>SYCP3 antibody was raised using the N terminal of SYCP3 corresponding to a region with amino acids VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE</p>

<p>Factor B antibody was raised in Mouse using purified factor B from human blood as the immunogen.</p>

<p>Rabbit polyclonal PUB16 antibody</p>

<p>CBFB antibody was raised in Rabbit using Human CBFB as the immunogen</p>

<p>Armenian Hamster monoclonal CD61 antibody (FITC)</p>

<p>Hexokinase antibody was raised in mouse using recombinant human Hexokinase1 (1-917aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal KRBP antibody</p>

<p>ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.</p>

<p>The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.</p>

<p>RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF</p>

<p>LYZ antibody was raised in Rabbit using Human LYZ as the immunogen</p>

<p>Rabbit polyclonal Ret antibody (Tyr1062)</p>

<p>CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD</p>

<p>Rat monoclonal CD4 antibody (allophycocyanin); IgG2b kappa; clone GK1.5</p>

<p>The TrkA antibody is a highly specialized protein complex that plays a crucial role in various Life Sciences research applications. It is commonly used as a tool for studying the functions and interactions of specific proteins, such as c-myc and alpha-fetoprotein. This antibody is widely recognized for its exceptional specificity and sensitivity, making it an ideal choice for researchers in the field.</p>

<p>TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM</p>

<p>Rabbit polyclonal HNRPH1 antibody (biotin)</p>

<p>Mouse monoclonal MOBKL2B antibody</p>

<p>The LIMK1 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor. It has been extensively tested and validated for its specificity and sensitivity in detecting LIMK1 protein levels in various biological samples. This antibody is widely used in life sciences research, particularly in studies related to progesterone signaling, interferon pathways, and chemokine regulation.</p>

<p>Rabbit polyclonal TFDP2 antibody</p>

<p>KCNJ2 antibody was raised in Rabbit using Human KCNJ2 as the immunogen</p>

<p>Rabbit polyclonal SFRS4 antibody</p>

<p>MRE11A antibody was raised in Rabbit using Human MRE11A as the immunogen</p>

<p>AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDA</p>

<p>DCUN1D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT</p>

<p>Calpain 1 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa mu-calpain subunit as the immunogen.</p>

<p>HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR</p>

<p>Rabbit polyclonal IRAK1 antibody (Thr387)</p>

<p>DAZAP1 antibody was raised using the middle region of DAZAP1 corresponding to a region with amino acids GKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQG</p>

<p>RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER</p>

<p>The SRF antibody is a highly specialized monoclonal antibody that targets the Serum Response Factor (SRF). This hormone plays a crucial role in regulating gene expression and cell growth. The SRF antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications.</p>

<p>Rabbit polyclonal RIMS2 antibody</p>

<p>Rabbit polyclonal Galectin 9 antibody (HRP)</p>

<p>Complement C6 antibody is an insulin-like growth factor that belongs to the family of antibodies. It is found in human serum and plays a crucial role in immune response regulation. This monoclonal antibody specifically targets complement component C6, which is involved in the formation of the membrane attack complex (MAC) during the complement cascade. By binding to C6, this antibody inhibits MAC assembly and prevents cell lysis. Additionally, Complement C6 antibody has been shown to have potential therapeutic applications in various fields, including Life Sciences research and clinical diagnostics. Its specificity and high affinity make it a valuable tool for studying complement-mediated immune responses and investigating diseases associated with dysregulation of the complement system.</p>

<p>The MRE11 antibody is a highly specialized monoclonal antibody that targets the MRE11 protein. This protein plays a crucial role in DNA repair and maintenance, making it an essential component for cellular health. The MRE11 antibody is specifically designed to neutralize the activity of the MRE11 protein, preventing its interaction with other molecules involved in DNA repair processes.</p>

<p>Rabbit polyclonal Chl87 antibody</p>

<p>The Cytochrome C antibody is a highly specialized tool used in Life Sciences research. This monoclonal antibody is designed to specifically target and bind to cytochrome C, an essential component of the electron transport chain. By binding to cytochrome C, this antibody can help researchers study various biological processes such as cell signaling, apoptosis, and oxidative stress.</p>

<p>The PDLIM2 antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to neutralize interleukins, which are proteins involved in immune responses. This antibody specifically targets dimers and inhibitors of interleukins, preventing their activity and reducing inflammation. Additionally, the PDLIM2 antibody has been shown to have an impact on amyloid plaque formation, which is associated with Alzheimer's disease. It also inhibits the activity of serine proteases, enzymes involved in various physiological processes. Furthermore, this antibody has been found to reduce superoxide and glutamate levels, protecting cells from oxidative stress and excitotoxicity. The PDLIM2 antibody can be used for various applications in research, such as studying virus surface antigens or investigating fatty acid metabolism. Its high specificity and affinity make it a valuable tool for scientists working in the field of Life Sciences.</p>

<p>Rabbit polyclonal RPS12 antibody</p>

<p>Mouse monoclonal TAL1 antibody</p>

<p>TNF beta antibody was raised in rabbit using highly pure recombinant human TNF-beta as the immunogen.</p>

<p>Human IgE antibody was raised in mouse using immunoglobulin E from myelomatous human serum.</p>

<p>The PCNA antibody is an activated antibody that is widely used in Life Sciences research. It plays a crucial role in DNA replication and repair by interacting with various proteins involved in these processes. The PCNA antibody has been shown to have a chemopreventive effect by inhibiting the synthesis of sulfates, which are known to promote carcinogenesis. This monoclonal antibody is extensively utilized in polymerase chain reactions (PCR), immunochemical studies, and immunohistochemical detection of PCNA expression in tissues. Additionally, the PCNA antibody has been found to interact with intracellular reactive oxygen species and act as a pro-apoptotic protein. Its ability to modulate epidermal growth factor signaling pathways makes it a valuable tool for studying cellular processes and developing potential therapeutic interventions.</p>

<p>Rabbit Polyclonal STX1A antibody (Ser14)</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>HMGB4 antibody was raised in Rabbit using Human HMGB4 as the immunogen</p>

<p>Mouse monoclonal V beta 13.1 TCR antibody (FITC)</p>

<p>Rabbit polyclonal Tau antibody (Ser404)</p>

<p>Purified Polyclonal DYNC1I2 antibody</p>

<p>SF3B3 antibody was raised using the middle region of SF3B3 corresponding to a region with amino acids TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Rabbit Polyclonal LGALS13 antibody</p>

<p>The RAD51 antibody is a highly specific polyclonal antibody that targets the RAD51 protein, an oncogene homolog involved in DNA repair and recombination. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It is available as both a monoclonal antibody and a polyclonal antibody.</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>The CD48 antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets CD48, a protein found on the surface of human cells. This antibody has been extensively studied and shown to have high affinity and specificity for CD48. It can be used in various research applications, such as immunohistochemistry, flow cytometry, and western blotting.</p>

<p>Mouse monoclonal SERPINB4 antibody</p>

<p>Rabbit polyclonal ALOX5 antibody (Ser271)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>LGALS3 antibody was raised using the N terminal of LGALS3 corresponding to a region with amino acids GASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPG</p>

<p>RALGPS2 antibody was raised using the N terminal of RALGPS2 corresponding to a region with amino acids MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP</p>

<p>Beta Amyloid aa 1-16 Monoclonal Antibody (HRP)</p>

<p>Rabbit polyclonal OR4C6 antibody</p>

<p>Purified Polyclonal Cardiotrophin 1 antibody</p>

<p>Mouse monoclonal Glucagon antibody (Biotin)</p>