Anticuerpos primarios

<p>Mouse monoclonal PDE4A antibody</p>

<p>BUB3 antibody was raised in Rabbit using Human BUB3 as the immunogen</p>

<p>Mouse monoclonal PGAM2 antibody</p>

<p>Rabbit polyclonal UTP14A antibody</p>

<p>Rabbit Polyclonal KLRAQ1 antibody</p>

<p>The HOXD10 antibody is a highly reactive monoclonal antibody that is widely used in Life Sciences research. It has been specifically designed to neutralize the activity of fibrinogen, a key protein involved in blood clotting. This antibody offers ultrasensitive detection capabilities and can be used for various applications such as immunoassays and Western blotting.</p>

<p>hCG beta antibody was raised in mouse using human chorionic gonadotropin beta as the immunogen.</p>

<p>Rabbit polyclonal TNIP1 antibody</p>

<p>Rabbit polyclonal VTN antibody</p>

<p>C10ORF96 antibody was raised using the middle region of C10Orf96 corresponding to a region with amino acids QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE</p>

<p>NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT</p>

<p>Rabbit polyclonal YME1L1 antibody</p>

<p>Rabbit polyclonal UNC45B antibody</p>

<p>The PSMA4 antibody is a highly specific monoclonal antibody that targets the proteasome subunit alpha type-4 (PSMA4). PSMA4 plays a crucial role in protein degradation and is involved in various cellular processes. This antibody recognizes specific epitopes on PSMA4 and can be used for research purposes, such as Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>The TRPC4 antibody is a monoclonal antibody that specifically targets and binds to the TRPC4 protein. This protein plays a crucial role in various cellular processes, including calcium signaling and ion channel regulation. By binding to TRPC4, this antibody can modulate its activity and function.</p>

<p>Rabbit Polyclonal GIRK1 antibody (Ser185)</p>

<p>Mouse monoclonal PIP4K2A antibody</p>

<p>The JAK2 antibody is a highly specific and reliable tool used in Life Sciences research. It is an antigen that targets autoantibodies and can be used for various applications. This antibody, whether polyclonal or monoclonal, binds to the nuclear protein JAK2, allowing for the detection and analysis of JAK2 expression in cells and tissues.</p>

<p>BOLL antibody was raised in Rabbit using Human BOLL as the immunogen</p>

<p>The FOXO3A antibody is a high-quality polyclonal antibody used in Life Sciences. It specifically targets the mineralocorticoid receptor and has antiviral properties. This antibody is produced using excipients and globulin, ensuring its purity and effectiveness. It acts as an antigen, binding to specific proteins and neutralizing their activity. The FOXO3A antibody can be used as a medicament in various applications, including research and diagnostics. Its low density allows for easy handling and accurate dosing. Additionally, this antibody has been shown to inhibit the growth of certain factors that promote cell proliferation, making it a valuable tool in studying cellular processes. Autoantibodies against FOXO3A have also been identified, highlighting its significance in immune responses. Choose the FOXO3A antibody for reliable results and precise targeting of protein complexes.</p>

<p>CAPS2 antibody was raised in Rabbit using Human CAPS2 as the immunogen</p>

<p>Rabbit Polyclonal MAPKAPK2 antibody (Thr222)</p>

<p>The ACTA1 antibody is a highly specialized monoclonal antibody that targets the ACTA1 protein. This protein is involved in muscle contraction and is essential for proper muscle function. The antibody specifically binds to the ACTA1 protein, preventing its interaction with other molecules and inhibiting muscle contraction.</p>

<p>Rabbit Polyclonal RNF14 antibody</p>

<p>Rabbit polyclonal Aquaporin PIP antibody</p>

<p>Mouse monoclonal PANK3 antibody</p>

<p>Mouse monoclonal PDHA1 antibody</p>

<p>The WNT2 antibody is a polyclonal antibody that specifically targets the protein WNT2. This antibody is widely used in Life Sciences research to study the role of WNT2 in various biological processes. WNT2 is an important signaling molecule involved in cell development, proliferation, and differentiation. It plays a crucial role in embryonic development and tissue homeostasis.</p>

<p>IKBKE antibody was raised in Mouse using a purified recombinant fragment of IKBKE(aa1-257) expressed in E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication processes, thereby preventing bacterial growth. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>KLF4 antibody was raised in Mouse using a purified recombinant fragment of human KLF4 expressed in E. coli as the immunogen.</p>

<p>SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids ERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE</p>

<p>ACER1 antibody was raised in rabbit using the C terminal of ACER1 as the immunogen</p>

<p>RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ</p>

<p>The GSK3B antibody is a highly specific and potent monoclonal antibody that targets the fms-like tyrosine kinase 3 beta (GSK3B). It is designed to neutralize the activity of GSK3B, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the function of GSK3B.</p>

<p>The FOXO4 antibody is a highly specialized substance that belongs to the group of antibodies. It is specifically designed to target and bind to the FOXO4 protein, which plays a crucial role in pluripotent stem cells. This antibody can be used in various research applications, including immunohistochemical staining and affinity ligand purification.</p>

<p>EML1 antibody was raised in Rabbit using Human EML1 as the immunogen</p>

<p>ATG4C antibody was raised in Rabbit using Human ATG4C as the immunogen</p>

<p>Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV</p>

<p>MS4A7 antibody was raised in Rabbit using Human MS4A7 as the immunogen</p>

<p>The YBX1 antibody is a highly specialized monoclonal antibody that targets the growth factor YBX1. It is designed for immobilization on electrodes and is commonly used in electrochemical impedance studies. This antibody has been extensively tested and proven to effectively detect and measure YBX1 levels in various samples, including human serum. It can also be used to detect autoantibodies against YBX1.</p>

<p>Rabbit polyclonal CREB1 antibody (Ser133)</p>

<p>The GRK5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets and binds to the activated form of the GRK5 protein. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rabbit Polyclonal NFkB p65 antibody (Ser536)</p>

<p>WDSOF1 antibody was raised using the N terminal of WDSOF1 corresponding to a region with amino acids WSPAGRATEMKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREY</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. This powerful compound is highly effective in treating tuberculosis infections. It works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its bactericidal activity has been extensively studied using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. It also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Affinity purified Rabbit polyclonal Fumarate hydratase antibody</p>

<p>Rabbit polyclonal GTF2IRD1 antibody</p>

<p>MKRN1 antibody was raised using the C terminal of MKRN1 corresponding to a region with amino acids RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW</p>

<p>Purified Polyclonal RAB23 antibody</p>

<p>Purified Polyclonal PI3K p85 beta antibody</p>

<p>The VEGFR2 antibody is a highly specialized monoclonal antibody that targets vascular endothelial growth factor receptor 2 (VEGFR2). It is designed to specifically bind to this growth factor receptor and inhibit its activity. This antibody can be used in various life science research applications, including the study of angiogenesis, tumor growth, and cardiovascular development.</p>

<p>ADRB2 antibody was raised in rabbit using the middle region of ADRB2 as the immunogen</p>

<p>KIAA0284 antibody was raised using the N terminal of KIAA0284 corresponding to a region with amino acids QLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQVFGVLESPEL</p>

<p>HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD</p>

<p>C10ORF96 antibody was raised using the middle region of C10Orf96 corresponding to a region with amino acids QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES</p>

<p>The Histamine H3 Receptor antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the histamine H3 receptor, which is involved in various physiological processes, including neurotransmission and immune responses. This antibody is designed to specifically recognize and bind to the histamine H3 receptor protein found in humans.</p>

<p>Goat anti-monkey IgG (biotin) was raised in goat using monkey IgG as the immunogen.</p>

<p>CYP4F12 antibody was raised in Rabbit using Human CYP4F12 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This drug exhibits bactericidal activity, effectively eliminating the bacteria causing the infection. Its mechanism of action involves binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes necessary for bacterial survival. The efficacy of this drug has been demonstrated through rigorous testing using advanced techniques such as patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations in the body, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranos</p>

<p>Purified Polyclonal MYO6 antibody</p>

<p>Akt, also known as Protein Kinase B (PKB), is a key enzyme involved in regulating cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to signals like growth factors. Upon activation through specific phosphorylation events, Akt drives essential cellular functions, including promoting cell survival, stimulating protein synthesis via mTOR, regulating glucose uptake, and facilitating blood vessel formation and cell movement. Due to its frequent hyperactivation in cancers, Akt is a significant target in cancer therapies, and its role in glucose metabolism links it to conditions like insulin resistance and type 2 diabetes.</p>

<p>HPD antibody was raised in Rabbit using Human HPD as the immunogen</p>

<p>Rabbit polyclonal MRPL14 antibody</p>

<p>Rabbit polyclonal RPS25 antibody</p>

<p>Rabbit polyclonal NFAT5 antibody (Ser155)</p>

<p>Goat anti-mouse IgM (HRP) was raised in goat using murine IgM mu chain as the immunogen.</p>

<p>CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV</p>

<p>Rabbit polyclonal ISL2 antibody</p>

<p>The CD153 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD153, a protein expressed on pluripotent stem cells. This antibody can be used in various research assays and experiments to study the function and behavior of pluripotent stem cells.</p>

<p>Rabbit Polyclonal Caveolin antibody (Tyr14)</p>

<p>Rabbit polyclonal GABARAPL1 antibody (biotin)</p>

<p>EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG</p>

<p>Affinity purified Rabbit polyclonal EML1 antibody</p>

<p>Kallikrein 2 Monoclonal Antibody BSA/Azide Free</p>

<p>The S100 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a phosphatase and interacts with other proteins such as erythropoietin, interleukin-6, actin, collagen, fibrinogen, and β-catenin. This antibody is widely used in the field of Life Sciences for research purposes.</p>

<p>The NT3 antibody is a specific antibody that targets adeno-associated inhibitors. It is commonly used in pluripotent stem cell research to study the effects of dopamine and other neurotransmitters. This antibody can also be used in various assays, such as enzyme-linked immunosorbent assays (ELISAs) or Western blotting, to detect the presence of NT3 in samples. Additionally, it has been shown to have potential therapeutic applications in treating diseases related to autoantibodies or collagen disorders. The NT3 antibody has high specificity and sensitivity, making it a valuable tool for researchers and clinicians alike.</p>

<p>STAT3 antibody was raised in Mouse using a purified recombinant fragment of STAT3 expressed in E. coli as the immunogen.</p>

<p>The Human IgG antibody is a powerful inhibitory factor that targets various proteins and factors in the body. It has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other cytokines involved in immune response regulation. This Monoclonal Antibody specifically binds to alpha-fetoprotein, autoantibodies, and antiphospholipid antibodies, neutralizing their effects. Additionally, it has been found to have a significant impact on interferon signaling pathways.</p>

<p>Purified Polyclonal Lutropin beta antibody</p>

<p>Purified Polyclonal PDGFA antibody</p>

<p>The CDCA2 antibody is a highly effective protein kinase inhibitor that belongs to the family of kinase inhibitors. It is used in the field of Life Sciences as a valuable tool for studying various cellular processes. The CDCA2 antibody specifically targets TGF-beta, which is a key signaling molecule involved in cell growth and differentiation. This antibody can be used in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. In addition to its use as a research tool, the CDCA2 antibody has also shown potential therapeutic applications, particularly in the field of regenerative medicine. It has been found to enhance the differentiation potential of mesenchymal stem cells and promote tissue regeneration. With its ability to inhibit specific kinases and modulate important cellular pathways, the CDCA2 antibody is an indispensable tool for researchers in various fields of study.</p>

<p>Rabbit polyclonal JAK1 antibody (Tyr1022)</p>

<p>Rabbit polyclonal TPM1 antibody</p>

<p>The Netrin 1 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Netrin 1, a protein involved in various cellular processes. It has been extensively tested and validated for its high specificity and affinity towards Netrin 1.</p>

<p>Rabbit polyclonal BLM antibody (Thr99)</p>

<p>MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN</p>

<p>LOC728227 antibody was raised using the C terminal of LOC728227 corresponding to a region with amino acids  GAGGAKSRGGQKAASARVKKPRRRGGKKPGQAKSHGGREQKAAAAGCKKP</p>

<p>RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids KIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGG</p>

<p>The GCP3 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and exhibits strong antigen-antibody reaction capabilities. This antibody is particularly effective in quantitating growth factors and neutralizing reactive substances in adipose tissues. With its unique properties, the GCP3 antibody can be used as a powerful tool for researchers and clinicians alike.</p>

<p>Rabbit polyclonal ATF7 antibody</p>

<p>Purified Polyclonal CHAC1 antibody</p>

<p>The Apelin antibody is a multidrug that belongs to the class of Polyclonal Antibodies. It targets apelin, which is a growth factor involved in various physiological processes. The antibody can be used for research purposes in the field of Life Sciences, particularly in studies related to lipase activity, adipose tissue function, and cell signaling pathways. It has been shown to have potential therapeutic applications in the treatment of conditions such as obesity and cardiovascular diseases. The Apelin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option based on their specific experimental needs. With its ability to detect and bind to apelin with high specificity and sensitivity, this antibody is an invaluable tool for studying the role of apelin in various biological processes.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. Known for its bactericidal activity, this drug effectively treats tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Metabolized through different metabolic transformations, including hydrolysis and oxidation, this drug specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The STAT3 antibody is a highly effective tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets the STAT3 protein, which plays a crucial role in various cellular processes such as growth factor signaling and actin filament formation. By binding to STAT3, this antibody allows researchers to study its activation and function.</p>

<p>Rabbit polyclonal ILF2 antibody (HRP)</p>

<p>Rabbit Polyclonal eIF2 alpha antibody (Ser51)</p>

<p>CD5 antibody (Spectral Red) was raised in rat using CD5/Lyt-1 as the immunogen.</p>

<p>Purified Polyclonal TSG6 antibody</p>

<p>The Annexin VII antibody is a highly specialized antibody used in the field of Life Sciences. It has cytotoxic properties and acts as a growth factor, promoting cell proliferation and survival. This antibody is capable of neutralizing the activity of adipose lipase, an enzyme involved in the breakdown of fats. It belongs to the class of Polyclonal Antibodies, which are produced by multiple B-cell clones and recognize different epitopes on the target protein. The Annexin VII antibody also exhibits natriuretic effects and has been shown to be effective against multidrug-resistant bacteria. Additionally, it can be used as a monoclonal antibody for targeted therapy or as an antibiotic to inhibit the growth of lipoprotein lipase and triglyceride lipase, enzymes involved in lipid metabolism.</p>