Anticuerpos primarios

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Affinity purified Rabbit polyclonal ZPBP antibody</p>

<p>Rabbit polyclonal MAP3K1 antibody (FITC)</p>

<p>CHMP2A antibody was raised in Rabbit using Human CHMP2A as the immunogen</p>

<p>Purified Rabbit polyclonal TUBA1/3/4 antibody</p>

<p>The STAT3 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the STAT3 protein, which plays a crucial role in various cellular processes. This antibody is made from cellulose and DNA aptamers, which are small molecules that can bind to specific proteins.</p>

<p>Rabbit polyclonal SKIL antibody</p>

<p>CD90 antibody was raised in rat using murine T-Cell hybridoma c6/G8, produced by fusion of porl insulin-specific BALB/c T cells with the AKR thymoma line BW 5147 as the immunogen.</p>

<p>Rabbit polyclonal RPS10 antibody</p>

<p>Rabbit Polyclonal FAK antibody (Tyr397)</p>

<p>FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL</p>

<p>The Hemocyanin antibody is a valuable product in the field of Life Sciences. This antibody specifically targets fatty acids and is widely used in research involving Antibodies. It acts as a family kinase inhibitor, preventing the activation of kinases that play a crucial role in cell signaling pathways. Additionally, this antibody has been shown to interact with collagen, epidermal growth factor, and interleukin-6, making it an essential tool for studying the effects of these molecules on various biological processes.</p>

<p>Rabbit polyclonal AGTRL1 antibody</p>

<p>Rabbit polyclonal SERPINB8 antibody</p>

<p>Rabbit polyclonal TNF alpha antibody (biotin)</p>

<p>The U1A antibody is a highly specialized polyclonal antibody that is used in various immunoassays. It is specifically designed to neutralize the activity of the human protein U1A, which plays a crucial role in RNA splicing. This antibody can be used in research and diagnostic applications to study the function and regulation of U1A.</p>

<p>Midkine antibody was raised in rabbit using highly pure recombinant human Midkine as the immunogen.</p>

<p>Purified Polyclonal ANKRD1 antibody</p>

<p>Pex2 antibody was raised in rabbit using the C terminal of Pex2 as the immunogen</p>

<p>SLC27A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL</p>

<p>CD18 antibody (PE) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.</p>

<p>GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH</p>

<p>Purified Polyclonal MOV10L1 antibody</p>

<p>Rabbit polyclonal Fibronectin antibody (Prediluted for IHC)</p>

<p>CD19 antibody (FITC) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT</p>

<p>PNMA2 antibody was raised in rabbit using the middle region of PNMA2 as the immunogen</p>

<p>C19ORF15 antibody was raised using the C terminal Of C19Orf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK</p>

<p>CD23 antibody (FITC) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>

<p>NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV</p>

<p>CD44 antibody (biotin) was raised in rat using murine CD44 as the immunogen.</p>

<p>CD16 antibody (Spectral Red) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>TLR4 antibody was raised in rabbit using the middle region of TLR4 as the immunogen</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK</p>

<p>TMEM16C antibody was raised using the C terminal of TMEM16C corresponding to a region with amino acids  AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL</p>

<p>The ARID1A antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and inhibits the activity of ARID1A, a protein involved in pyrimidine synthesis. By blocking this key enzyme, the ARID1A antibody acts as a potent inhibitor of pyrimidine synthesis pathway, preventing the production of essential building blocks for DNA and RNA. Additionally, this antibody has been shown to act as a DNA repair inhibitor, further highlighting its potential applications in research and drug development. With its ability to selectively target and inhibit pyrimidine synthesis, the ARID1A antibody is an invaluable tool for scientists studying cellular processes and developing novel therapeutic strategies.</p>

<p>Parainfluenza type 2 antibody (FITC) was raised in mouse using parainfluenza virus, type 2 as the immunogen.</p>

<p>CYP2R1 antibody was raised in rabbit using the middle region of CYP2R1 as the immunogen</p>

<p>CD106 antibody was raised in Mouse using human CD106/VCAM-1 as the immunogen.</p>

<p>Rabbit polyclonal Synaptophysin antibody (Prediluted for IHC)</p>

<p>CD44 antibody (PE-CY7) was raised in mouse using human CD44 as the immunogen</p>

<p>CD25 antibody (PE) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>

<p>PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS</p>

<p>CD19 antibody (CY5) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH</p>

<p>Mouse monoclonal HSV1 + HSV2 antibody (FITC)</p>

<p>CD19 antibody (PE) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>Rabbit polyclonal VARS2 antibody</p>

<p>Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE</p>

<p>CNR1 antibody was raised in rabbit using the N terminal of CNR1 as the immunogen</p>

<p>CD4a antibody (PE) was raised in mouse using CD4a as the immunogen.</p>

<p>CD19 antibody (FITC) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>PAFAH1B3 antibody was raised using the middle region of PAFAH1B3 corresponding to a region with amino acids GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN</p>

<p>TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV</p>

<p>CD11a antibody (PE-CY7) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>UGT1A7 antibody was raised using the N terminal of UGT1A7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN</p>

<p>FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE</p>

<p>SCGB1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQKPRESIIKLMEKIA</p>

<p>C9ORF4 antibody was raised using the N terminal Of C9Orf4 corresponding to a region with amino acids PAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYD</p>

<p>Serpinc1 antibody was raised in rabbit using the C terminal of Serpinc1 as the immunogen</p>

<p>C7orf16 antibody was raised in rabbit using the middle region of C7orf16 as the immunogen</p>

<p>SPO11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC</p>

<p>CD28 antibody was raised in rabbit using residues 72-85 [SQQLQVYSKTGFN] of the Ig-V region of human CD28 as the immunogen.</p>

<p>Mouse monoclonal Cytokeratin antibody cocktail (Prediluted for IHC)</p>

<p>CD3e antibody (PE) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>CCND1 antibody was raised in rabbit using the middle region of CCND1 as the immunogen</p>

<p>CD45RC antibody (biotin) was raised in rat using an exon C-depentent epitope of the CD45 glycoprotein as the immunogen.</p>

<p>MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR</p>

<p>CD22 antibody (PE) was raised in rat using CD22 as the immunogen.</p>

<p>A monoclonal antibody fragment (nanobody) that binds to von Willebrand factor (vWF), thereby inhibiting platelet adhesion.</p>

<p>CD3e antibody (biotin) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.</p>

<p>TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH</p>

<p>The Beta catenin antibody is a highly versatile antibody that plays a crucial role in various biological processes. It is commonly used in life sciences research, particularly in the field of pluripotent stem cells. This antibody specifically targets β-catenin, a protein that is involved in cell adhesion and signaling pathways.</p>

<p>CD45.2 antibody (biotin) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD49d antibody (FITC) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>

<p>CD19 antibody (Allophycocyanin-CY7) was raised in mouse using human CD19 as the immunogen.</p>

<p>CD105 antibody (FITC) was raised in mouse using membrane preparation of human B-lineage leukemia cells as the immunogen.</p>

<p>The cMet antibody is a highly effective inhibitor that targets low-density receptors in the Life Sciences field. It has been shown to significantly reduce cortisol concentration and inhibit the activity of androgen, thereby providing relief from various hormonal imbalances. This medicament is specifically designed to target antibodies, including trastuzumab and polyclonal antibodies, which are known to play a crucial role in autoimmune disorders. The cMet antibody works by blocking the activation of tyrosine kinases, which are responsible for initiating abnormal cell growth and proliferation. With its exceptional performance in laboratory assays, this antibody has proven to be a valuable tool for researchers and clinicians alike in the pursuit of understanding and combating autoimmune diseases.</p>

<p>SNAG1 antibody was raised in rabbit using the middle region of SNAG1 as the immunogen</p>

<p>Avil antibody was raised in rabbit using the N terminal of Avil as the immunogen</p>

<p>C2ORF18 antibody was raised using the middle region of C2Orf18 corresponding to a region with amino acids GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVA</p>

<p>CD122 antibody (Allophycocyanin) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.</p>

<p>DHRSX antibody was raised in rabbit using the C terminal of DHRSX as the immunogen</p>

<p>Streptococcus group A antibody (biotin) was raised in goat using group A Streptococci as the immunogen.</p>

<p>ZBTB46 antibody was raised in rabbit using the N terminal of ZBTB46 as the immunogen</p>

<p>GLUT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST</p>

<p>F7 antibody was raised in rabbit using the middle region of F7 as the immunogen</p>

<p>SFRP5 antibody was raised in rabbit using residues 25-38 [APARCEEYDYYGWQ] of human SFRP5 as the immunogen.</p>

<p>MAGEL2 antibody was raised in rabbit using the C terminal of MAGEL2 as the immunogen</p>

<p>CD45 antibody (biotin) was raised in Rat using CD45/LCA as the immunogen.</p>

<p>Rabbit polyclonal TNFSF14 antibody</p>

<p>IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids  DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE</p>

<p>Affinity purified Sheep polyclonal BSA antibody (HRP)</p>

<p>CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL</p>

<p>CD38 antibody (PE) was raised in rat using CD38 as the immunogen.</p>

<p>ZKSCAN1 antibody was raised in rabbit using the middle region of ZKSCAN1 as the immunogen</p>

<p>ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD</p>

<p>FAM3C antibody was raised using the C terminal of FAM3C corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD</p>

<p>FLJ33706 antibody was raised in rabbit using the C terminal of FLJ33706 as the immunogen</p>