Anticuerpos primarios

<p>HS2ST1 antibody was raised using the N terminal of HS2ST1 corresponding to a region with amino acids GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR</p>

<p>SAP30BP antibody was raised in rabbit using the C terminal of SAP30BP as the immunogen</p>

<p>TMEM176B antibody was raised in rabbit using the C terminal of TMEM176B as the immunogen</p>

<p>Neprilysin antibody was raised in rabbit using a synthetic peptide comprising internal sequence of the human neprilysin protein as the immunogen.</p>

<p>GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR</p>

<p>Pde2a antibody was raised in rabbit using the N terminal of Pde2a as the immunogen</p>

<p>Purified Polyclonal SHARP1 antibody</p>

<p>RHOT1 antibody was raised using the middle region of RHOT1 corresponding to a region with amino acids ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR</p>

<p>NEI3 antibody was raised in rabbit using residues 164-177 (LRAESEVKKQKGRMLG) of the human NEI3 protein as the immunogen.</p>

<p>DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT</p>

<p>C2orf60 antibody was raised in rabbit using the middle region of C2ORF60 as the immunogen</p>

<p>LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen</p>

<p>Carboxypeptidase D antibody was raised using the N terminal of CPD corresponding to a region with amino acids SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPP</p>

<p>LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE</p>

<p>DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE</p>

<p>Purified Polyclonal p116 Rip antibody</p>

<p>SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY</p>

<p>SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL</p>

<p>ZNF610 antibody was raised in rabbit using the N terminal of ZNF610 as the immunogen</p>

<p>FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE</p>

<p>The AIM2 antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to AIM2, a protein that plays a crucial role in the activation of inflammasomes. By binding to AIM2, this antibody inhibits its function, preventing the activation of downstream signaling pathways that lead to inflammation and cell death.</p>

<p>SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogen</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC</p>

<p>Lig3 antibody was raised in rabbit using the middle region of Lig3 as the immunogen</p>

<p>Purified Polyclonal TRPS1 antibody</p>

<p>PRDM9 antibody was raised in rabbit using the middle region of PRDM9 as the immunogen</p>

<p>FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP</p>

<p>SLC39A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL</p>

<p>IFN gamma antibody was raised in goat using highly pure recombinant rat IFN-gamma as the immunogen.</p>

<p>IL17 antibody was raised in rabbit using highly pure recombinant hIL-17A as the immunogen.</p>

<p>Tmem147 antibody was raised in rabbit using the N terminal of Tmem147 as the immunogen</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR</p>

<p>BDNF antibody was raised in rabbit using highly pure recombinant human BDNF as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. Its efficacy has been demonstrated through extensive studies using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified Polyclonal ACSL6 antibody</p>

<p>ATP11B antibody was raised using the N terminal of ATP11B corresponding to a region with amino acids DIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGETNLKTHVAVPETA</p>

<p>Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG</p>

<p>FAM20A antibody was raised using the N terminal of FAM20A corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF</p>

<p>Apof antibody was raised in rabbit using the C terminal of Apof as the immunogen</p>

<p>JMJD2C antibody was raised in rabbit using the middle region of JMJD2C as the immunogen</p>

<p>SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL</p>

<p>PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED</p>

<p>PF4 antibody was raised in rabbit using highly pure recombinant hPF-4 as the immunogen.</p>

<p>ZNF258 antibody was raised in rabbit using the middle region of ZNF258 as the immunogen</p>

<p>BTBD15 antibody was raised in rabbit using the C terminal of BTBD15 as the immunogen</p>

<p>SREBF1 antibody was raised in rabbit using the N terminal of SREBF1 as the immunogen</p>

<p>PARK7 antibody was raised in rabbit using residues 167-189 (AIVEALNGKEVAAQVKAPLVLKD) of human PARK7 (DJ-1) as the immunogen.</p>

<p>RELM alpha antibody was raised in rabbit using residues 31-44 of the mouse RELMalpha protein as the immunogen.</p>

<p>ZBTB33 antibody was raised in rabbit using the N terminal of ZBTB33 as the immunogen</p>

<p>RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA</p>

<p>PER2 antibody was raised in rabbit using the middle region of PER2 as the immunogen</p>

<p>EVX1 antibody was raised in rabbit using the N terminal of EVX1 as the immunogen</p>

<p>PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL</p>

<p>RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER</p>

<p>Psenen antibody was raised in rabbit using the N terminal of Psenen as the immunogen</p>

<p>ASCL4 antibody was raised in rabbit using the N terminal of ASCL4 as the immunogen</p>

<p>DUSP12 antibody was raised in rabbit using the N terminal of DUSP12 as the immunogen</p>

<p>TMCC1 antibody was raised using the C terminal of TMCC1 corresponding to a region with amino acids ERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEAC</p>

<p>IL10 antibody was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.</p>

<p>KIF2A antibody was raised using the N terminal of KIF2A corresponding to a region with amino acids IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPS</p>

<p>SLC25A35 antibody was raised using the N terminal of SLC25A35 corresponding to a region with amino acids  DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI</p>

<p>ZNF138 antibody was raised in rabbit using the middle region of ZNF138 as the immunogen</p>

<p>The Cytokeratin 18 antibody is a highly activated monoclonal antibody that specifically targets cytokeratin 18, a protein found in human serum. This antibody is cationic in nature and has been extensively studied for its ability to bind to cytokeratin 18 and induce cytotoxic effects. It has been used in various research applications, including immunohistochemistry and western blotting, to detect the presence of cytokeratin 18 in different tissues and cell types.</p>

<p>EHMT2 antibody was raised in rabbit using the N terminal of EHMT2 as the immunogen</p>

<p>CFTR antibody was raised in rabbit using a synthetic peptide, G(103) R I I A S Y D P D N K E E R(117), as the immunogen.</p>

<p>PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE</p>

<p>Goat anti-rabbit IgG Fc was raised in goat using rabbit igG, Fc fragment as the immunogen.</p>

<p>SYT3 antibody was raised using the N terminal of SYT3 corresponding to a region with amino acids VSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGG</p>

<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>

<p>SpUlp2 antibody was raised in rabbit using residues 622-635 [SNNERQSLSSGSND] of the SpUlp2 protein as the immunogen.</p>

<p>Pigs antibody was raised in rabbit using the C terminal of Pigs as the immunogen</p>

<p>SLC34A3 antibody was raised in rabbit using the middle region of SLC34A3 as the immunogen</p>

<p>Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV</p>

<p>NRP1 antibody was raised in rabbit using the N terminal of NRP1 as the immunogen</p>

<p>KLF14 antibody was raised in rabbit using the N terminal of KLF14 as the immunogen</p>

<p>SPINT1 antibody was raised in rabbit using the C terminal of SPINT1 as the immunogen</p>

<p>DMBX1 antibody was raised in rabbit using the middle region of DMBX1 as the immunogen</p>

<p>ZNF619 antibody was raised in rabbit using the N terminal of ZNF619 as the immunogen</p>

<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>

<p>TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV</p>

<p>IGF BP7 antibody was raised in rabbit using highly pure recombinant human IGF-BP7 as the immunogen.</p>

<p>FOXN4 antibody was raised in rabbit using the C terminal of FOXN4 as the immunogen</p>

<p>Purified Polyclonal CK1 alpha antibody</p>

<p>CYP4X1 antibody was raised using the middle region of CYP4X1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP</p>

<p>Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV</p>

<p>ZNFN1A5 antibody was raised in rabbit using the N terminal of ZNFN1A5 as the immunogen</p>

<p>PTCH2 antibody was raised in rabbit using residues 226-235 [GPFASLEGFR] of the human PTCH2 protein as the immunogen.</p>

<p>CDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDRED</p>

<p>Abca1 antibody was raised in rabbit using the middle region of Abca1 as the immunogen</p>

<p>IKZF3 antibody was raised in rabbit using the C terminal of IKZF3 as the immunogen</p>

<p>Mbtd1 antibody was raised in rabbit using the middle region of Mbtd1 as the immunogen</p>

<p>FGF17 antibody was raised in goat using highly pure recombinant human FGF-17 as the immunogen.</p>

<p>Purified Polyclonal TRA2A antibody</p>

<p>ARHGAP20 antibody was raised in rabbit using the middle region of ARHGAP20 as the immunogen</p>

<p>SLC10A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP</p>

<p>CACNB2 antibody was raised in rabbit using the C terminal of CACNB2 as the immunogen</p>

<p>Purified Polyclonal HARS antibody</p>