Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.606 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.771 productos)
- Anticuerpos del metabolismo(277 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
NOTCH2 antibody
<p>The NOTCH2 antibody is a monoclonal antibody that targets the NOTCH2 receptor, which plays a crucial role in various morphogenetic processes. This antibody acts as a metallopeptidase inhibitor, preventing the cleavage of NOTCH2 and allowing it to function properly. The NOTCH2 antibody is produced using recombinant human protein and has been extensively tested for its specificity and effectiveness. It can be used in various research applications, including gel chromatography, immunohistochemistry, and Western blotting. By targeting the NOTCH2 receptor, this antibody provides valuable insights into the signaling pathways involved in development and disease progression. Choose the NOTCH2 antibody for reliable and accurate results in your research endeavors.</p>p14 ARF antibody
<p>The p14 ARF antibody is an extracellular antibody that targets interleukin and autoantibodies. It is a medicament that can be used for testing compounds in the Life Sciences field. This antibody, when used in research, has shown affinity for ligands and can be used to study pluripotent stem cells. It is solubilized and available as polyclonal antibodies. The p14 ARF antibody also has potential applications as an inhibitor in the development of new medicines.</p>Lactoferrin antibody (HRP)
<p>Lactoferrin antibody was raised in Mouse using purified human lactoferrin as the immunogen.</p>TRAF3 antibody
<p>The TRAF3 antibody is a highly specialized and potent cytotoxic agent that is designed to target specific proteins involved in cellular signaling pathways. It acts as an inhibitor by neutralizing the activity of TRAF3, a protein known to be involved in various biological processes such as cell growth, differentiation, and apoptosis. This antibody can be used in a wide range of applications, including research in Life Sciences, where it can be utilized to study the role of TRAF3 in different cellular processes. Additionally, this monoclonal antibody has been shown to have high affinity towards its target and can effectively bind to TRAF3 with minimal cross-reactivity towards other proteins or glycoconjugates. With its unique properties and specificity, the TRAF3 antibody is an invaluable tool for scientists and researchers looking to unravel the complexities of cellular signaling pathways.</p>PPIA antibody
<p>PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids FRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFED</p>Albumin antibody
<p>The Albumin antibody is a powerful tool for researchers working with human albumin. This monoclonal antibody specifically targets and binds to albumin, allowing for precise detection and analysis. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>PDE10A antibody
<p>The PDE10A antibody is a highly specialized monoclonal antibody that targets the phosphodiesterase 10A enzyme. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including autoimmune disorders and inflammatory conditions. It specifically binds to the PDE10A antigen, inhibiting its activity and modulating downstream signaling pathways.</p>PDK3 antibody
<p>PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK</p>COT antibody
<p>The COT antibody is a monoclonal antibody that specifically targets retinal photoreceptor cells. It has been widely used in the field of Life Sciences for its anti-neoplastic properties. The COT antibody works by binding to specific receptors on the surface of cancer cells, triggering endocytic uptake and subsequent destruction of the cancerous cells. Additionally, this antibody has shown promising results in combination with adeno-associated viruses for targeted drug delivery.</p>ACLY antibody
<p>The ACLY antibody is an activated antibody used in Life Sciences research. It is commonly used in immunoassays and neutralizing experiments to study the role of ACLY (adenylate cyclase-associated protein) in various cellular processes. This monoclonal antibody specifically targets ACLY and can be used to detect its presence in samples such as human serum or cell lysates. The ACLY antibody has been shown to inhibit the activity of ACLY, which plays a crucial role in collagen synthesis, adipose tissue mineralization, and other cellular functions. Researchers often use this antibody to investigate the effects of ACLY inhibitors or other compounds, such as sorafenib, on cellular pathways involving ACLY. With its high specificity and sensitivity, the ACLY antibody is a valuable tool for studying the function and regulation of ACLY in different biological contexts.</p>BCL2L1 antibody
<p>The BCL2L1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets the BCL2-like 1 protein, which is involved in regulating cell survival and apoptosis. This antibody specifically recognizes and binds to the activated form of the protein kinase, effectively neutralizing its activity.</p>PCK1 antibody
<p>PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS</p>FGF21 antibody
<p>The FGF21 antibody is a growth factor that is used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to FGF21, a protein involved in various physiological processes. The FGF21 antibody can be used for research purposes, such as studying the role of FGF21 in different disease models or investigating its potential as a therapeutic target.</p>ALDH1L1 antibody
<p>The ALDH1L1 antibody is a monoclonal antibody that targets the α1 subunit of glutamate receptors. It is widely used in Life Sciences research for its ability to specifically bind to this target protein. The ALDH1L1 antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>Tie2 antibody
<p>The Tie2 antibody is a highly specialized monoclonal antibody that targets the carboxyl terminus of the Tie2 receptor. It is commonly used in Life Sciences research to study the role of Tie2 in various biological processes. This antibody specifically binds to human hepatocytes and has been shown to inhibit elastase activity, which is crucial for maintaining tissue integrity. The Tie2 antibody is produced using state-of-the-art hybridization techniques and purified using bovine γ-globulin and streptavidin. Its high specificity and low viscosity make it an ideal tool for studying the natriuretic properties of Tie2 and its potential therapeutic applications.</p>ACO2 antibody
<p>The ACO2 antibody is a monoclonal antibody used in Life Sciences research. It has been developed to target specific proteins and molecules involved in various biological processes. This antibody has shown potential in the study of amyloid plaque formation, as well as in the development of inhibitors that can block the aggregation of these plaques. Additionally, the ACO2 antibody has been found to be effective in assessing microvessel density, which is crucial for understanding angiogenesis and tumor growth. This antibody can also be used to detect activated cells and electrodes, making it a valuable tool in cell biology research. Furthermore, the ACO2 antibody has shown reactivity against proteins such as collagen, alpha-fetoprotein, sclerostin, chemokines, interleukins, and cytotoxic factors present in human serum. Its high specificity and sensitivity make it an indispensable asset for researchers working in various fields of Life Sciences.</p>DDX52 antibody
<p>DDX52 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE</p>AKT3 antibody
<p>The AKT3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the c-myc protein, which is involved in cell growth and proliferation. This antibody has a high affinity for its target and can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.</p>L1CAM antibody
<p>The L1CAM antibody is a monoclonal antibody that specifically targets the L1 cell adhesion molecule. This nuclear antigen is found in various tissues and plays a crucial role in cell adhesion and migration. The L1CAM antibody can be used for immunohistochemistry to detect the expression of L1CAM in different tissues, including blood plasma, as well as for research purposes in the field of Life Sciences.</p>Cyclin E1 antibody
<p>Human cyclin E1 non-phosphopeptide (Thr395) region immunogen, Rabbit polyclonal Cyclin E1 antibody</p>CD44 antibody
<p>CD44 antibody was raised in mouse using recombinant human CD44 (21-145aa) purified from E. coli as the immunogen.</p>Cyclin B1 antibody
<p>The Cyclin B1 antibody is a polyclonal antibody that specifically targets the growth factor Cyclin B1. It is widely used in Life Sciences research to study the role of Cyclin B1 in various cellular processes. This antibody has been shown to be highly specific and sensitive, allowing for accurate detection and quantification of Cyclin B1 levels in samples.</p>MAD2L1 antibody
<p>The MAD2L1 antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and neutralize the MAD2L1 protein, which plays a crucial role in cell division and growth regulation. This antibody can be used in various research applications, including studying the effects of MAD2L1 on colony-stimulating factor (CSF) production and granulosa cell development. Additionally, the MAD2L1 antibody has shown potential as an antiviral agent, with binding properties that can inhibit the activity of certain viral proteins. With its high specificity and efficacy, this monoclonal antibody is a valuable tool for scientists and researchers in their quest to understand and manipulate cellular processes.</p>COG4 antibody
<p>COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR</p>Histone H4 antibody
<p>The Histone H4 antibody is a growth factor monoclonal antibody that specifically binds to histone H4 proteins. It is widely used in Life Sciences research for various applications, including studying chromatin structure, gene regulation, and epigenetics. This antibody has the ability to neutralize histone H4 binding proteins and can be used to investigate their function. Additionally, the Histone H4 antibody has been shown to have reactive properties, making it an ideal tool for detecting histone H4 modifications and protein-protein interactions. Its high specificity and sensitivity make it a valuable tool for researchers working on anticancer agents, interferon signaling pathways, chemokine biology, antiviral responses, cytotoxicity studies, and multidrug resistance mechanisms. With its versatility and reliability, the Histone H4 antibody is an essential component of any research arsenal in the field of Life Sciences.</p>ALKBH3 antibody
<p>ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS</p>MDM2 antibody
<p>The MDM2 antibody is a highly activated antibody used in Life Sciences research. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. By binding to MDM2, this antibody inhibits its function and prevents it from interacting with other proteins involved in cell signaling pathways.</p>CHK1 antibody
<p>The CHK1 antibody is a polyclonal antibody that specifically targets the hyaluronan receptors. It is widely used in life sciences research for the immobilization and detection of biomolecules. This antibody has been shown to be highly effective in detecting and quantifying mesenchymal stem cells that are activated. The CHK1 antibody can also be used in various applications such as chromatographic and colloidal assays. Additionally, this monoclonal antibody has cytotoxic properties and has been proven to effectively target collagen in blood plasma samples. With its high specificity and sensitivity, the CHK1 antibody is a valuable tool for researchers in the field of life sciences.</p>GPR34 antibody
<p>The GPR34 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the GPR34 antigen, which plays a crucial role in various cellular processes. This antibody is commonly used in studies related to sclerostin, collagen, and other nuclear proteins.</p>PDIA4 antibody
<p>The PDIA4 antibody is a monoclonal antibody used in life sciences research. It is specifically designed to target and neutralize PDIA4, a protein involved in various cellular processes. This antibody has been shown to have a significant impact on mesenchymal stem cells and endothelial growth, making it a valuable tool for studying these cell types. Additionally, the PDIA4 antibody can be used in techniques such as immunofluorescence and immunohistochemistry to detect the presence of PDIA4 in biological samples. Its high specificity and sensitivity make it an ideal choice for researchers working with PDIA4-related studies.</p>BRCA1 antibody
<p>The BRCA1 antibody is a highly specialized cytotoxic agent used in life sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody specifically targets the BRCA1 protein, which is involved in DNA repair and maintenance of genomic stability. By binding to BRCA1, the antibody disrupts its function, leading to cell death.</p>MRPL10 antibody
<p>MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE</p>TFAP2A antibody
<p>The TFAP2A antibody is a monoclonal antibody that targets the transcription factor AP-2 alpha (TFAP2A). This antibody is commonly used in Life Sciences research to study the role of TFAP2A in various cellular processes. TFAP2A is known to regulate the expression of genes involved in fatty acid metabolism, epidermal growth factor signaling, and cell proliferation. The TFAP2A antibody specifically recognizes and binds to TFAP2A, allowing researchers to investigate its function and localization within cells. This antibody can be used in techniques such as immunofluorescence, immunohistochemistry, and Western blotting to detect and analyze TFAP2A expression levels. With its high specificity and sensitivity, the TFAP2A antibody is an invaluable tool for studying the intricate mechanisms of gene regulation and cellular processes mediated by TFAP2A.</p>NASP antibody
<p>NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV</p>FBXO5 antibody
<p>FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL</p>GATA4 antibody
<p>The GATA4 antibody is a highly specific and targeted molecule drug that plays a crucial role in the field of Life Sciences. It is known to regulate various processes such as fatty acid metabolism, insulin production, and plasma levels. This antibody is designed to bind to GATA4, a transcription factor involved in the regulation of gene expression.</p>Turkey RBC antibody (Texas Red)
<p>Turkey RBC antibody (Texas Red) was raised in rabbit using turkey erythrocytes as the immunogen.</p>ACO2 antibody
<p>The ACO2 antibody is a highly specific monoclonal antibody that binds to ACO2, an enzyme involved in the tricarboxylic acid cycle. This antibody has been extensively studied and validated for its use in various research applications in the field of life sciences. It can be used for the detection and quantification of ACO2 in human hepatocytes, as well as for studying the role of ACO2 in cellular processes such as metabolism and energy production. The ACO2 antibody has also been shown to interact with other binding proteins, including interferon and chemokine receptors such as CXCR4. Its immobilization on electrodes allows for efficient detection and analysis of ACO2 levels in biological samples, making it a valuable tool for researchers working in the fields of molecular biology and biochemistry.</p>UNC45A antibody
<p>UNC45A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG</p>TGF α antibody
<p>The TGF alpha antibody is a highly effective monoclonal antibody that is used in Life Sciences research. It has been shown to neutralize the activity of TGF-alpha, a potent chemokine that plays a crucial role in cell growth and development. This antibody binds to TGF-alpha and prevents it from activating its receptors, thereby inhibiting downstream signaling pathways. The TGF alpha antibody is colloidal in nature, allowing for easy and efficient delivery into cells. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Additionally, this antibody has been found to have potential therapeutic applications in diseases involving abnormal TGF-alpha signaling, such as certain types of cancer and neurodegenerative disorders. Its high specificity and affinity make it an invaluable tool for researchers studying the role of TGF-alpha in various biological processes.</p>HPD antibody
<p>HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV</p>Integrin α 7 antibody
<p>Integrin alpha 7 antibody is a highly specialized monoclonal antibody that targets the integrin alpha 7 protein. This antibody has been extensively studied and proven to be effective in various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.</p>cRel antibody
<p>The cRel antibody is a monoclonal antibody that specifically targets the nuclear factor cRel. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and immune responses. The cRel antibody can be used in a variety of assays to study the function and localization of this protein. Additionally, it has been shown to have potential therapeutic applications in the field of life sciences. By targeting cRel, this antibody may help researchers gain valuable insights into diseases such as cancer, autoimmune disorders, and inflammatory conditions. Its high specificity and affinity make it a valuable tool for scientists working in the field of molecular biology and immunology.</p>CD4 antibody
<p>The CD4 antibody is a highly specific monoclonal antibody that targets the CD4 protein, which is expressed on the surface of certain immune cells. This antibody has been extensively studied and has shown various biological effects. It has been found to inhibit syncytia formation, a process in which infected cells fuse together to form giant multinucleated cells. Additionally, the CD4 antibody can block the interaction between CD4 and its ligands, such as the IL-2 receptor, thereby modulating immune responses.</p>VCAM1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it effectively treats tuberculosis infections. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Parainfluenza type 3 antibody
<p>Parainfluenza type 3 antibody was raised in mouse using parainfluenza virus, type 3 as the immunogen.</p>Fn14 antibody
<p>The Fn14 antibody is a specific antiserum that has chemotactic activity and can target opioid peptides. It is a monoclonal antibody that is widely used in the field of Life Sciences. The Fn14 antibody has been shown to inhibit androgen biosynthesis, making it a valuable tool in research related to hormone regulation. This antibody specifically binds to the antigen binding domain of Fn14, a protein involved in various cellular processes. It has also been used in studies on steroid metabolites and pleomorphic adenoma. Additionally, the Fn14 antibody can be conjugated to a carbon electrode for electrochemical detection methods, such as phenyl phosphate assays.</p>TEX14 antibody
<p>The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.</p>SMC3 antibody
<p>SMC3 antibody was raised in Rat using Mouse SMC3 and GST fusion protein as the immunogen.</p>LIN7C antibody
<p>LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV</p>Tetraspanin 1 antibody
<p>Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA</p>EPO antibody
<p>EPO antibody was raised in Mouse using a purified recombinant fragment of human EPO expressed in E. coli as the immunogen.</p>
