Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.609 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.691 productos)
- Anticuerpos del metabolismo(278 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
ZNF780A antibody
<p>ZNF780A antibody was raised in rabbit using the N terminal of ZNF780A as the immunogen</p>Pureza:Min. 95%HELT antibody
<p>HELT antibody was raised in rabbit using the middle region of HELT as the immunogen</p>Pureza:Min. 95%CD38 antibody (FITC)
<p>CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molHTR3A antibody
<p>HTR3A antibody was raised in rabbit using the middle region of HTR3A as the immunogen</p>Pureza:Min. 95%Aqp2 antibody
<p>Aqp2 antibody was raised in rabbit using the middle region of Aqp2 as the immunogen</p>Pureza:Min. 95%CD8a antibody (Azide Free)
<p>CD8a antibody (Azide free) was raised in rat using murine thymus or spleen as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molTIMP4 antibody
<p>TIMP4 antibody was raised in rabbit using the middle region of TIMP4 as the immunogen</p>Pureza:Min. 95%Dynactin 2 antibody
<p>Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI</p>Pureza:Min. 95%DOCK2 antibody
<p>DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA</p>Pureza:Min. 95%GIMAP5 antibody
<p>GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL</p>Pureza:Min. 95%CD106 antibody (PE)
<p>CD106 antibody (PE) was raised in Mouse using human CD106/VCAM-1 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molMDC antibody
<p>MDC antibody was raised in rabbit using highly pure recombinant hMDC as the immunogen.</p>Pureza:Min. 95%CD45R antibody (Spectral Red)
<p>CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molMEGF9 antibody
<p>The MEGF9 antibody is a highly specialized antibody that targets the MEGF9 protein. This protein plays a crucial role in various biological processes, including iron homeostasis and growth factor signaling. The MEGF9 antibody has been shown to have neutralizing effects on the activity of MEGF9, making it an important tool for researchers in the field of life sciences.</p>Pureza:Min. 95%CD23 antibody (PE-CY7)
<p>CD23 antibody (PE-CY7) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molNotch 4 homolog antibody
<p>Notch 4 homolog antibody was raised in rabbit using a synthetic peptide representing an internal region of the human NOTCH homolog 4 (NOTCH4) protein as the immunogen.</p>Pureza:Min. 95%Inhibin α antibody
<p>Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP</p>Pureza:Min. 95%CD23 antibody (biotin)
<p>CD23 antibody (biotin) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD105 antibody (biotin)
<p>CD105 antibody (biotin) was raised in mouse using membrane preparation of human B-linage leukemia cells as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molSLC25A44 antibody
<p>SLC25A44 antibody was raised in rabbit using the middle region of SLC25A44 as the immunogen</p>Pureza:Min. 95%MIP2 antibody
<p>MIP2 antibody was raised in rabbit using highly pure recombinant murine MIP-2 as the immunogen.</p>Pureza:Min. 95%TCEAL8 antibody
<p>TCEAL8 antibody was raised in rabbit using the middle region of TCEAL8 as the immunogen</p>Pureza:Min. 95%CA2 antibody
<p>CA2 antibody was raised in rabbit using the C terminal of CA2 as the immunogen</p>Pureza:Min. 95%CD3e antibody (biotin)
<p>CD3e antibody (biotin) was raised in rat using CD3e as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molMAGEA11 antibody
<p>MAGEA11 antibody was raised in rabbit using the middle region of MAGEA11 as the immunogen</p>Pureza:Min. 95%Ard1b antibody
<p>Ard1b antibody was raised in rabbit using the middle region of Ard1b as the immunogen</p>Pureza:Min. 95%MRE11A antibody
<p>MRE11A antibody was raised in rabbit using the middle region of MRE11A as the immunogen</p>Pureza:Min. 95%GABRA1 antibody
<p>GABRA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL</p>Pureza:Min. 95%ODF4 antibody
<p>ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL</p>Pureza:Min. 95%PRDM15 antibody
<p>PRDM15 antibody was raised in rabbit using the C terminal of PRDM15 as the immunogen</p>Pureza:Min. 95%OR1G1 antibody
<p>OR1G1 antibody was raised in rabbit using the C terminal of OR1G1 as the immunogen</p>Pureza:Min. 95%CD117 antibody (Spectral Red)
<p>CD117 antibody (CY5) was raised in rat using murine CD117/c-Kit as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molChondroadherin antibody
<p>Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL</p>Pureza:Min. 95%CD25 antibody (biotin)
<p>CD25 antibody (biotin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molZNF562 antibody
<p>ZNF562 antibody was raised in rabbit using the middle region of ZNF562 as the immunogen</p>Pureza:Min. 95%OTUB2 antibody
<p>OTUB2 antibody was raised in rabbit using the N terminal of OTUB2 as the immunogen</p>Pureza:Min. 95%ZNF491 antibody
<p>ZNF491 antibody was raised in rabbit using the N terminal of ZNF491 as the immunogen</p>Pureza:Min. 95%FAM70A antibody
<p>FAM70A antibody was raised using the N terminal of FAM70A corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR</p>Pureza:Min. 95%BSCL2 antibody
<p>BSCL2 antibody was raised in rabbit using the C terminal of BSCL2 as the immunogen</p>Pureza:Min. 95%SEMA6A antibody
<p>SEMA6A antibody was raised using the middle region of SEMA6A corresponding to a region with amino acids ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR</p>Pureza:Min. 95%C1QTNF4 antibody
<p>C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids RRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASEL</p>Pureza:Min. 95%α 2 HS glycoprotein antibody
<p>Alpha 2 HS glycoprotein antibody was raised against Human Alpha-2-HS Glycoprotein.</p>Pureza:Min. 95%CD49b antibody (Allophycocyanin-CY7)
<p>CD49b antibody (Allophycocyanin) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molSEC23IP antibody
<p>SEC23IP antibody was raised in rabbit using the N terminal of SEC23IP as the immunogen</p>Pureza:Min. 95%CD22 antibody (FITC)
<p>CD22 antibody (FITC) was raised in rat using CD22 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molWDR33 antibody
<p>WDR33 antibody was raised using the N terminal of WDR33 corresponding to a region with amino acids IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC</p>Pureza:Min. 95%EFHC1 antibody
<p>EFHC1 antibody was raised in rabbit using the N terminal of EFHC1 as the immunogen</p>Pureza:Min. 95%HLA-DPA1 antibody
<p>HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT</p>Pureza:Min. 95%Ivuxolimab
CAS:<p>Ivuxolimab is an OX40 (also known as CD134; TNFRSF4) agonist monoclonal antibody.</p>SLC25A6 antibody
<p>SLC25A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ</p>Pureza:Min. 95%CD44 antibody (FITC)
<p>CD44 antibody (FITC) was raised in rat using murine CD44 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD49b antibody (FITC)
<p>CD49b antibody (FITC) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD45 antibody (Allophycocyanin)
<p>CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD49d antibody (Azide Free)
<p>CD49d antibody (Azide free) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>CD19 antibody (Allophycocyanin)
<p>CD19 antibody (Allophycocyanin) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molGoat anti Cat IgM mu chain
<p>Goat anti-cat IgM mu chain was raised in goat using highly pure cat IgM in Freund's adjuvant as the immunogen.</p>Pureza:Min. 95%ZNF598 antibody
<p>ZNF598 antibody was raised in rabbit using the middle region of ZNF598 as the immunogen</p>Pureza:Min. 95%MMP9 antibody
<p>The MMP9 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and bind to the activated form of matrix metalloproteinase 9 (MMP9). This biomolecule plays a crucial role in various physiological and pathological processes, including cell-extracellular matrix interactions, tissue remodeling, and inflammation.</p>TAAR5 antibody
<p>TAAR5 antibody was raised in rabbit using the middle region of TAAR5 as the immunogen</p>Pureza:Min. 95%SLC25A36 antibody
<p>SLC25A36 antibody was raised using the N terminal of SLC25A36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG</p>Pureza:Min. 95%Rnf183 antibody
<p>Rnf183 antibody was raised in rabbit using the N terminal of Rnf183 as the immunogen</p>Pureza:Min. 95%CD106 antibody (Azide Free)
<p>CD106 antibody (Azide free) was raised in rat using murine CD106/VCAM-1 as the immunogen.</p>LBP antibody
<p>LBP antibody was raised using the middle region of LBP corresponding to a region with amino acids LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV</p>Pureza:Min. 95%CCK antibody
<p>CCK antibody was raised using the middle region of CCK corresponding to a region with amino acids IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS</p>Pureza:Min. 95%TRIM48 antibody
<p>TRIM48 antibody was raised in rabbit using the C terminal of TRIM48 as the immunogen</p>Pureza:Min. 95%RanBP3 antibody
<p>RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH</p>Pureza:Min. 95%Arnt antibody
<p>Arnt antibody was raised in rabbit using the C terminal of Arnt as the immunogen</p>Pureza:Min. 95%CD3 antibody (PE-CY7)
<p>CD3 antibody (PE-CY5.5) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>ZNF565 antibody
<p>ZNF565 antibody was raised in rabbit using the middle region of ZNF565 as the immunogen</p>Pureza:Min. 95%ALDH6A1 antibody
<p>ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW</p>Pureza:Min. 95%CD45RC antibody (FITC)
<p>CD45 antibody (FITC) was raised in Rat using as exon C-dependent epitope of CD45 glycoprotin as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD11b antibody (PE)
<p>CD11b antibody (FITC) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molC1orf83 antibody
<p>C1orf83 antibody was raised in rabbit using the N terminal of C1ORF83 as the immunogen</p>Pureza:Min. 95%CD30 antibody (PE)
<p>CD30 antibody (PE) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molADCYAP1R1 antibody
<p>ADCYAP1R1 antibody was raised in rabbit using the C terminal of ADCYAP1R1 as the immunogen</p>Pureza:Min. 95%USP3 antibody
<p>USP3 antibody was raised in rabbit using the middle region of USP3 as the immunogen</p>Pureza:Min. 95%CD20 antibody (Allophycocyanin-CY7)
<p>CD20 antibody (Allophycocyanin) was raised in mouse using human CD20 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molArsg antibody
<p>Arsg antibody was raised in rabbit using the C terminal of Arsg as the immunogen</p>Pureza:Min. 95%CD28 antibody (FITC)
<p>CD28 antibody (FITC) was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molEPOr antibody
<p>EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL</p>Pureza:Min. 95%EXT2 antibody
<p>EXT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW</p>Pureza:Min. 95%ICAM1 antibody
<p>ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.</p>Pureza:Min. 95%CD11a antibody (PE-CY7)
<p>CD11a antibody (PE) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molDusp19 antibody
<p>Dusp19 antibody was raised in rabbit using the N terminal of Dusp19 as the immunogen</p>Pureza:Min. 95%CD49d antibody (PE)
<p>Mouse monoclonal CD49d antibody (FITC)</p>Pureza:Min. 95%Peso molecular:0 g/molAADACL4 antibody
<p>AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR</p>Pureza:Min. 95%CD38 antibody (Spectral Red)
<p>CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD49d antibody (PE)
<p>CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD45.1 antibody (PE)
<p>CD45.1 antibody (PE-CY7) was raised in mouse using CD45.1 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCANT1 antibody
<p>CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG</p>Pureza:Min. 95%CD23 antibody (Azide Free)
<p>CD23 antibody (Azide free) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>HPV18 E7 antibody
<p>Please enquire for more information about HPV18 E7 antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>
