Anticuerpos primarios

<p>The CD4 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to CD4, a protein found on the surface of certain cells, including T-helper cells. This antibody has been extensively studied and proven to have various applications in research and diagnostics.</p>

<p>The NPM antibody is a test substance used in the field of Life Sciences. It is an isolated nucleic acid that is known for its high protein thermal stability. This antibody exhibits cytotoxic properties and has been extensively studied for its antibody activity against various targets. It has shown promising results as an anticancer agent and is being explored for its potential use in medicinal compositions. The NPM antibody is derived from bioactive natural products and is available as Polyclonal Antibodies. Its efficacy can be tested using electrophoresis techniques, and it specifically targets nuclear markers.</p>

<p>ERBB2 antibody was raised in Mouse using a purified recombinant fragment of human ERBB2 (aa750-987) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>CCNE2 antibody was raised in Rabbit using Human CCNE2 as the immunogen</p>

<p>LUM antibody was raised in Rabbit using Human LUM as the immunogen</p>

<p>Rabbit polyclonal DAPP1 antibody</p>

<p>Rabbit polyclonal TRIM28 antibody (FITC)</p>

<p>TAGAP antibody was raised in rabbit using the N terminal of TAGAP as the immunogen</p>

<p>Rabbit polyclonal VBP1 antibody</p>

<p>The Synapsin antibody is a specific antibody that has various applications in the field of life sciences. It can be used as an anticoagulant and has been found to have neutralizing effects on hepcidin and TGF-β1. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. It has been shown to interact with a range of antigens, including interleukin-6 (IL-6) and IL-17A, making it a versatile tool for research purposes. Additionally, this antibody can be used as a medicament in certain applications. Its ability to bind to isolated nucleic acids and fibrinogen further adds to its potential use in various scientific investigations.</p>

<p>The JunB antibody is an activated antibody that targets the JunB protein, a transcription factor involved in various cellular processes. It is commonly used in life sciences research to study the role of JunB in different signaling pathways. This antibody specifically recognizes and binds to JunB, allowing researchers to investigate its function and regulation.</p>

<p>VWF antibody (HRP) was raised in sheep using Canine vWF purified from plasma as the immunogen.</p>

<p>LTB4DH antibody was raised using the N terminal Of Ltb4Dh corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR</p>

<p>TER119 antibody is a monoclonal antibody that targets a cell antigen involved in glycosylation processes. It is commonly used in the field of Life Sciences for research purposes. TER119 antibody specifically recognizes and binds to the TER119 antigen, which is expressed on erythroid cells. This antibody has been shown to inhibit the proton-coupled transferrin uptake by these cells, thereby affecting their growth and development. Additionally, TER119 antibody has been found to modulate interleukin-6 signaling and reduce microvessel density, suggesting its potential as an anti-angiogenic agent. With its high specificity and affinity, TER119 antibody is a valuable tool for studying erythroid cell biology and understanding the role of glycosylation in various cellular processes.</p>

<p>MAP2K6 antibody was raised in Rabbit using Human MAP2K6 as the immunogen</p>

<p>EGFR antibody was raised in Rabbit using Human EGFR as the immunogen</p>

<p>SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE</p>

<p>The CCR4 antibody is a polyclonal antibody that specifically targets the C-C chemokine receptor 4 (CCR4). This receptor is involved in various biological processes, including immune response and inflammation. The CCR4 antibody can be used in life sciences research to study the function and expression of CCR4. It can also be used in diagnostic applications to detect the presence of CCR4 in samples. The CCR4 antibody is produced by hybridoma cells and is available as both polyclonal and monoclonal antibodies. It has been shown to have high specificity and sensitivity in detecting CCR4. The CCR4 antibody can be used in conjunction with other antibodies or molecules to further investigate the role of CCR4 in various physiological and pathological conditions.</p>

<p>Rabbit polyclonal UQCRFS1 antibody (HRP)</p>

<p>Mouse monoclonal UNG antibody</p>

<p>Goat anti Pig IgA secondary antibody (FITC)</p>

<p>BLyS antibody was raised in mouse using recombinant human BLyS (134-285aa) purified from E. coli as the immunogen.</p>

<p>NAT2 antibody was raised in Rabbit using Human NAT2 as the immunogen</p>

<p>Rabbit polyclonal TLN1 antibody</p>

<p>Affinity purified Rabbit polyclonal TMEM147 antibody</p>

The IKBE antibody is a monoclonal antibody that acts as a neutralizing molecule drug in the field of Life Sciences. It specifically targets insulin and has been extensively studied for its ability to inhibit the activity of TNF-α, a key inflammatory cytokine. This monoclonal antibody recognizes specific amino acid residues on the target molecule and effectively blocks its function. In addition to its role in neutralizing TNF-α, the IKBE antibody has also shown promising results in targeting other molecules such as ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) and autoantibodies associated with diseases like cryptosporidium infection. With its specificity and potential therapeutic applications, the IKBE antibody holds great promise in the field of immunotherapy.

<p>Affinity purified Rabbit polyclonal NDUFS8 antibody</p>

<p>The ATP6V1B1 antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets ATP6V1B1 protein, which plays a crucial role in the regulation of ascorbic acid transport, fatty acid metabolism, and collagen synthesis. This antibody is widely used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>The CPA1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets collagen and its phosphorylation site. This antibody acts as an inhibitor, preventing the substance responsible for collagen phosphorylation from functioning properly. By modulating the immune response and interfering with this process, the CPA1 antibody has potential applications in immunomodulation and treating diseases related to collagen dysfunction.</p>

<p>Mouse monoclonal Mitotic Cells antibody</p>

<p>The RPP38 antibody is a serum marker that targets mesothelin, a glycoprotein expressed in various cancers. It is a polyclonal antibody commonly used in life sciences research and has been found to be an interferon-stimulated gene. The RPP38 antibody can be utilized for the detection and quantification of mesothelin levels in biological samples, making it a valuable tool for diagnostic purposes. Additionally, this antibody has shown potential therapeutic applications in the development of targeted medicines. Its ability to specifically bind to mesothelin opens up possibilities for targeted drug delivery and immunotherapy approaches. The RPP38 antibody is also being studied for its role as an autoantibody and its interaction with other cellular components such as telomerase, pluripotent stem cell markers, glycogen synthase kinase, and methyl transferase enzymes. With its versatility and specificity, the RPP38 antibody is an indispensable tool in the field of antibodies and biomedical research.</p>

<p>CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG</p>

<p>The NGAL antibody is a monoclonal antibody that specifically targets the protein known as neutrophil gelatinase-associated lipocalin (NGAL). NGAL is involved in various physiological processes, including inflammation and tissue repair. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in its ability to neutralize the effects of TGF-beta, a growth factor involved in fibrosis and cancer progression. Additionally, the NGAL antibody has been used to inhibit endothelial growth and angiogenesis, making it a potential therapeutic option for diseases such as cancer. Furthermore, this antibody has shown efficacy in targeting amyloid plaque formation, which is implicated in neurodegenerative disorders like Alzheimer's disease. With its broad range of applications and potential therapeutic benefits, the NGAL antibody holds great promise for future research and clinical use.</p>

<p>The NGAL antibody is a highly effective monoclonal antibody that has neutralizing properties. It targets the colony-stimulating factor and has been shown to have a significant impact on mesenchymal stem cells. This antibody works by binding to lysyl-trna synthetase, preventing it from functioning properly. The NGAL antibody is formulated with high-quality excipients and has undergone extensive testing in various assays. It is a potent medicament that can be used for a range of applications in the Life Sciences field. Additionally, this antibody has antiviral properties and can be pegylated for enhanced efficacy. With its ability to bind to specific proteins, the NGAL antibody offers promising therapeutic potential in various research and clinical settings.</p>

<p>The OCT1 antibody is a highly specialized monoclonal antibody that specifically targets and binds to the OCT1 protein. This protein is involved in the transport of organic cations across cell membranes and plays a crucial role in various physiological processes. The OCT1 antibody has been extensively studied in the field of life sciences and has shown promising results in research related to growth factors, autoantibodies, and glutamate signaling.</p>

<p>Rabbit polyclonal CAR14 antibody</p>

<p>Rabbit polyclonal Neuroglobin antibody (FITC)</p>

<p>Plastin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS</p>

<p>Rabbit polyclonal DAPK3 antibody (Thr265)</p>

<p>Rabbit Polyclonal Smad3 antibody (Ser425)</p>

<p>ALB antibody was raised in Rabbit using Human ALB as the immunogen</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>EIF3C antibody was raised in Rabbit using Human EIF3C as the immunogen</p>

<p>The SDHB antibody is a highly specialized antibody that is used in various immunoassays and life science research. It is available as both monoclonal and polyclonal antibodies, offering a wide range of applications. This antibody specifically targets the SDHB protein, which plays a crucial role in cellular respiration and energy production.</p>

<p>B3GNT3 antibody was raised in Rabbit using Human B3GNT3 as the immunogen</p>

<p>Purified Rabbit polyclonal MYB24 antibody</p>

<p>GORAB antibody was raised in Rabbit using Human GORAB as the immunogen</p>

<p>Serotonin antibody was raised in rat using serotonin-BSA as the immunogen.</p>

<p>MED15 antibody was raised in Rabbit using Human MED15 as the immunogen</p>

<p>The YTHDF1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to YTHDF1, a protein involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs.</p>

<p>The RPS9 antibody is a growth factor that activates the 3-kinase and protein kinase pathways. It is a monoclonal antibody that specifically targets RPS9, a protein involved in ribosome biogenesis. This antibody has been shown to have a high affinity for RPS9 and can be used as a research tool to study its function in various cellular processes.</p>

<p>Rabbit polyclonal MAPK15 antibody</p>

<p>SMARCA4 antibody was raised in mouse using recombinant Swi/Snf Related, Matrix Associated, Actin Dependent Regulator Of Chromatin, Subfamily A, Member 4 (Smarca4)</p>

<p>CA 125 antibody was raised in mouse using purified human ovarian mucin antigen from ascitic fluid as the immunogen.</p>

<p>The CD253 antibody is a highly specialized monoclonal antibody that targets mesothelin, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of mesothelin. It binds specifically to mesothelin and can be used for various applications such as immunoassays, immunohistochemistry, and flow cytometry.</p>

<p>GGCX antibody was raised in Rabbit using Human GGCX as the immunogen</p>

<p>YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE</p>

<p>Plasminogen antibody (HRP) was raised in goat using human plasminogen purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal RBL1 antibody (Thr369)</p>

<p>The NRL antibody is a highly effective inhibitor used in various applications within the Life Sciences field. It is a monoclonal antibody that specifically targets and binds to the NRL protein. This antibody can be used for immobilization purposes, such as in immunoassays, where it can be attached to an electrode for quantitation of NRL protein levels. Additionally, the NRL antibody has shown potential in the treatment and/or prophylaxis of certain conditions associated with abnormal NRL expression or autoantibodies against NRL. With its high specificity and affinity, this antibody offers a valuable tool for researchers and scientists working in the field of molecular biology and diagnostics.</p>

<p>VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV</p>

<p>Rabbit polyclonal p53 antibody (Ser37)</p>

<p>Rabbit polyclonal p53 antibody (Ser6)</p>

<p>Rabbit polyclonal ZNF24 antibody</p>

<p>The NEK6 antibody is a highly specialized neurotrophic factor that has natriuretic properties. It belongs to the class of Life Sciences globulins and is known for its reactive nature. This antibody has neutralizing and inhibitory properties against TGF-β1, making it an effective tool in research and therapeutic applications. The NEK6 antibody is a monoclonal antibody, which means it is produced by a single clone of cells and exhibits high specificity for its target. It has been extensively studied for its cholinergic effects and has shown promising results as a potential medicament. Additionally, this monoclonal antibody interacts with sphingosine, further enhancing its therapeutic potential. Choose the NEK6 antibody for your research needs and unlock new possibilities in the field of neurobiology.</p>

<p>The BSG antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of chemokine antibodies and is specifically designed to target and bind to activated BSG (Basigin) proteins. This monoclonal antibody exhibits high affinity and specificity for BSG, making it an ideal tool for various research applications.</p>

<p>The RPS14 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the TGF-beta growth factor-1 receptor and acts as a potent inhibitor of its activity. This antibody has been extensively studied for its potential therapeutic applications, particularly in the field of antidiabetic treatment.</p>

<p>C16ORF78 antibody was raised using the middle region of C16Orf78 corresponding to a region with amino acids GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVL</p>

<p>Rabbit polyclonal PRKAG2 antibody</p>

<p>SUMO3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF</p>

<p>Rabbit polyclonal SMCR7L antibody</p>

<p>Rabbit polyclonal SERPINE2 antibody</p>

<p>The EpCAM Antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM), which plays a crucial role in cell adhesion and signaling. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>The HSP90AB1 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It specifically targets the heat shock protein 90 alpha family class B member 1 (HSP90AB1), which is involved in cell signaling, protein folding, and stabilization of client proteins. This antibody can be used in immunoassays to detect and quantify HSP90AB1 levels, making it an essential tool for researchers in the life sciences field.</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase essential for regulating cellular growth, survival, metabolism, and proliferation. Functioning within the PI3K/Akt/mTOR pathway, Akt responds to signals from growth factors or insulin to help cells adapt and maintain function. There are three Akt isoforms in humans—Akt1, Akt2, and Akt3—each encoded by distinct genes. Akt activation begins when these signals bind to receptors on the cell surface, activating phosphoinositide 3-kinase (PI3K), which produces PIP3 on the cell membrane. This attracts Akt to the membrane, where it becomes fully active through phosphorylation at Thr308 and Ser473, allowing it to move within the cell to phosphorylate proteins in key pathways.Akt’s primary roles include promoting cell survival by inhibiting apoptosis through inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also drives cell growth and proliferation by activating mTOR, a main regulator of protein synthesis, while suppressing growth-inhibiting pathways. In metabolic regulation, Akt increases glucose uptake and glycolysis, particularly in muscle and fat tissues, through GLUT4 translocation and hexokinase activation. Additionally, Akt promotes angiogenesis by upregulating VEGF to support tissue repair and contributes to cell migration, aiding wound healing and, in cancers, tumor spread. Its broad role in cell growth and survival often leads to hyperactivation in cancers, making it a target in cancer therapies, while its influence on glucose metabolism links it to insulin signaling, where pathway defects can lead to insulin resistance and type 2 diabetes.</p>

<p>Purified Polyclonal CHST1 antibody</p>

<p>The MYH4 antibody is a polyclonal antibody that specifically targets the cation channel MYH4. It is commonly used in life sciences research to study the role of MYH4 in various cellular processes. This antibody has been shown to have high affinity for MYH4 and can detect its presence in various samples, including human serum and nuclear extracts. The MYH4 antibody has also been used to study the DNA binding activity of MYH4 and its interaction with other proteins, such as fibrinogen and platelet fibrinogen. Its molecular weight complexes have been activated using sodium citrate, and it has been shown to inhibit the activity of enzymes like histidine and arginase. Overall, the MYH4 antibody is a valuable tool for researchers in the field of life sciences.</p>

<p>DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE</p>

<p>Mouse monoclonal DO11.10 TCR antibody (PE)</p>

<p>The GASP1 antibody is a highly specialized chloride antibody that is designed to target and inhibit the activity of non-coding RNA telomerase. This polyclonal antibody has been extensively tested and validated in various assays, making it a reliable tool for researchers studying telomerase activity. In addition, the GASP1 antibody has been shown to be a potent inhibitor of glycogen synthase kinase, an enzyme involved in cellular signaling pathways. This makes it an ideal choice for those looking to study the effects of GSK inhibition on cell function. With its high-flux design and inducer capabilities, the GASP1 antibody is an essential tool for any researcher looking to explore the role of telomerase and glycogen synthase kinase in various cellular processes.</p>

<p>NLN antibody was raised in Rabbit using Human NLN as the immunogen</p>

<p>Purified Polyclonal Topoisomerase 3 beta antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified Polyclonal CLCN4 antibody</p>

<p>Rabbit Polyclonal Tau antibody (Ser214)</p>

<p>Purified Rabbit polyclonal OR52N1 antibody</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.</p>

<p>The SARS-CoV-2 Spike Antibody is an acidic monoclonal antibody that has been developed for the detection and neutralization of the spike protein of the SARS-CoV-2 virus. This antibody specifically targets the spike protein, which plays a crucial role in viral entry into host cells. By binding to the spike protein, this antibody prevents the virus from attaching to and infecting healthy cells.</p>

<p>Purified Polyclonal cJun antibody</p>

<p>The E Cadherin antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers studying cell adhesion and signaling pathways. This antibody specifically targets E-cadherin, a protein that plays a crucial role in cell-cell adhesion and tissue integrity.</p>

<p>CHORDC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP</p>

<p>Yersinia enterocolitica O:9 antibody was raised in mouse using Yersinia enterocolitica serogroup O:9 strain as the immunogen.</p>

<p>The AP3B1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the AP3B1 protein, which plays a crucial role in intracellular vesicle trafficking. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>Goat anti-mouse IgM (biotin) (mu chain specific) was raised in goat using mouse IgM, Mu-chain as the immunogen.</p>

<p>C14ORF130 antibody was raised using the N terminal Of C14Orf130 corresponding to a region with amino acids MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ</p>

<p>Mouse monoclonal NIF3L1 antibody</p>

<p>Rabbit polyclonal NPR2 antibody</p>

<p>The JAK2 antibody is a highly effective inhibitor that targets the nuclear tyrosine kinase, JAK2. This monoclonal antibody blocks the activity of JAK2, preventing its interaction with other signaling molecules and inhibiting the downstream effects of JAK2 activation. By doing so, it disrupts the signaling pathway involved in various cellular processes, including glutamate and insulin metabolism.</p>