Anticuerpos primarios

<p>Rat monoclonal CD4 antibody (PE); mouse target; IgG2b kappa; clone RM4-4</p>

<p>DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF</p>

<p>FYTTD1 antibody was raised in rabbit using the middle region of FYTTD1 as the immunogen</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>Mouse monoclonal MOBKL1A antibody</p>

<p>NARG1 antibody was raised in mouse using recombinant Human Nmda Receptor Regulated 1 (Narg1)</p>

<p>Mouse RBC antibody (Texas Red) was raised in rabbit using mouse erythrocytes as the immunogen.</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>The CD51 antibody is a highly specific monoclonal antibody that can be used for ultrasensitive detection of protease activity. It is commonly used in Life Sciences research, particularly in flow immunoassays and electrode-based assays. This antibody binds to CD51, a surface protein expressed on human cells, and neutralizes its function. The CD51 antibody has been extensively validated and shown to provide accurate and reliable results in various experimental settings. Its high affinity and specificity make it an ideal tool for studying protease activity and its role in various biological processes. Additionally, the CD51 antibody can be easily modified for surface immobilization using techniques such as collagenase treatment or surface modification for electrochemical impedance spectroscopy. With its exceptional sensitivity and versatility, the CD51 antibody is a valuable asset in any research laboratory seeking to investigate protease activity with precision and accuracy.</p>

<p>IL1F10 antibody was raised in rabbit using the middle region of IL1F10 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Additionally, this drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP</p>

<p>The IRF3 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is specifically designed to target and bind to the nuclear protein IRF3, which plays a crucial role in regulating the immune response. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.</p>

<p>Mesothelin antibody is a polyclonal antibody that specifically targets the mesothelin antigen. It is commonly used in Life Sciences research to study the role of mesothelin in various biological processes. Mesothelin is an epidermal growth factor (EGF)-like protein that is expressed on the surface of certain cells, including mesothelial cells and some cancer cells. The antibody binds to mesothelin and can be used for neutralizing or detecting its presence in samples. Additionally, this antibody has been shown to have cross-reactivity with other antigens such as vitronectin and glucagon. Researchers often use it alongside other antibodies, such as cetuximab, to investigate the interactions between these proteins and their potential therapeutic applications.</p>

<p>Rabbit polyclonal CCL24 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal SFN antibody</p>

<p>The BSG antibody is a highly specialized product in the field of Life Sciences. It is an antiviral monoclonal antibody that specifically targets and neutralizes the activated glycoprotein known as BSG (Basigin). This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for BSG.</p>

<p>HSV1 gG antibody was raised in mouse using herpes simplex type 1 gG as the immunogen.</p>

<p>Rabbit polyclonal RPL17 antibody</p>

<p>Rabbit polyclonal COL4A2 antibody (FITC)</p>

<p>Mouse monoclonal IL1b antibody (biotin)</p>

<p>MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE</p>

<p>Rabbit polyclonal SMARCE1 antibody</p>

<p>AIM2 antibody is a cytotoxic monoclonal antibody that targets the AIM2 protein. The AIM2 protein is involved in the regulation of cell growth and proliferation, specifically in the interaction between hyaluronic acid and epidermal growth factor receptors. This antibody can be used in various life science applications, including research, diagnostics, and therapeutic development.</p>

<p>CD29 antibody was raised in mouse using recombinant human CD29 (34-141aa) purified from E. coli as the immunogen.</p>

<p>KCNJ15 antibody was raised in Rabbit using Human KCNJ15 as the immunogen</p>

<p>Rabbit polyclonal CYB5 antibody (FITC)</p>

<p>Rabbit polyclonal PRP31 antibody</p>

<p>Purified Polyclonal CDC23 antibody</p>

<p>Rabbit polyclonal KAD5 antibody</p>

<p>Mouse monoclonal RAB4AN antibody</p>

<p>Affinity purified Rabbit polyclonal GABPB1 antibody</p>

<p>Mouse monoclonal PSMD2 antibody</p>

<p>Rabbit polyclonal SLD5 antibody</p>

<p>MASTL antibody was raised in rabbit using the C terminal of MASTL as the immunogen</p>

<p>NCAPD2 antibody was raised in Rabbit using Human NCAPD2 as the immunogen</p>

<p>IL7 antibody was raised in mouse using highly pure recombinant human IL-7 as the immunogen.</p>

<p>NETO2 antibody was raised in Rabbit using Human NETO2 as the immunogen</p>

<p>Rabbit polyclonal FANCG antibody (Ser383)</p>

<p>Mouse monoclonal MHC Class I antibody (biotin)</p>

<p>The S100B antibody is an acidic monoclonal antibody that acts as an inhibitor of various proteins and enzymes. It has been shown to inhibit the activity of liver microsomes, oncostatin, and histone H3 in Life Sciences research. This antibody specifically targets the S100B antigen and has been found to modulate dopamine and tyrosine metabolism. Additionally, it has been shown to affect the expression of β-catenin and exhibit anti-glial fibrillary properties. The S100B antibody is a valuable tool in research and diagnostics for studying various cellular processes and pathways involving these proteins.</p>

<p>The PLK1 antibody is a monoclonal antibody that targets the amino-terminal region of PLK1, a protein involved in various cellular processes. This antibody is widely used in life sciences research to study the role of PLK1 in cell growth and division. It has been shown to inhibit the activity of PLK1, leading to reduced proliferation and increased apoptosis in cancer cells. Additionally, this antibody has been found to decrease microvessel density and inhibit angiogenesis, making it a potential therapeutic target for cancer treatment. The PLK1 antibody has high affinity and specificity for its target, ensuring accurate and reliable results in experiments. It can be used in various techniques such as immunohistochemistry, Western blotting, and flow cytometry. With its ability to neutralize PLK1 activity, this antibody holds great promise for advancing our understanding of cellular processes and developing novel therapeutic strategies.</p>

<p>GALK2 antibody was raised in Rabbit using Human GALK2 as the immunogen</p>

<p>Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>MIF4GD antibody was raised using the C terminal of MIF4GD corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD</p>

<p>GPR137 antibody was raised in Rabbit using Human GPR137 as the immunogen</p>

<p>Rabbit polyclonal BAI1 antibody</p>

<p>Rat monoclonal CD5 antibody (FITC)</p>

<p>The RON antibody is a polyclonal antibody that targets the growth factor receptor known as RON. It is also available in monoclonal form. This antibody binds to RON and can be used for various applications, including research and diagnostic purposes. RON is a receptor tyrosine kinase that plays a role in cell proliferation, migration, and survival. The binding of the RON antibody to this receptor can inhibit its activity, making it useful for studying the function of RON and its signaling pathways. Additionally, the RON antibody can be used as a therapeutic agent by blocking the interaction between RON and its ligands, potentially preventing or treating diseases associated with aberrant RON signaling.</p>

<p>Rabbit polyclonal FGF2 antibody (HRP)</p>

<p>Rabbit polyclonal NDKA antibody (FITC)</p>

<p>Purified Polyclonal MED29 antibody</p>

<p>The HRS antibody is a highly specialized product in the field of Life Sciences. It is widely used in research and diagnostic applications. This antibody is produced using mass spectrometric methods, ensuring its purity and quality.</p>

<p>CD247 antibody was raised in Rabbit using Human CD247 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Lamin A/C antibody</p>

<p>Rabbit polyclonal PMS1 antibody</p>

<p>SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM</p>

<p>CD276 antibody was raised in Rabbit using Human CD276 as the immunogen</p>

<p>Rabbit polyclonal HER2 antibody (Tyr877)</p>

<p>The CHRM2 antibody is a highly specialized polyclonal antibody that is designed to target the CHRM2 receptor. This receptor plays a crucial role in various biological processes, including cell signaling and neurotransmission. The CHRM2 antibody is available in both monoclonal and polyclonal forms, allowing for flexibility in experimental design.</p>

<p>The CD277 antibody is a protein that belongs to the class of autoantibodies. It is commonly used in Life Sciences research for its ability to detect and target specific proteins. The CD277 antibody has been shown to have neutralizing effects on various growth factors, such as TGF-beta1, fibronectin, and collagen. Additionally, it has been used in studies involving monoclonal antibodies like trastuzumab and interferon. The CD277 antibody is highly effective in detecting and blocking the activity of TGF-β1, making it an essential tool in research related to protein function and regulation.</p>

<p>RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY</p>

<p>Rabbit polyclonal STEA3 antibody</p>

<p>Rabbit Polyclonal APBB2 antibody</p>

<p>Rabbit polyclonal NNT antibody</p>

<p>The TGF alpha antibody is a monoclonal antibody that specifically targets and binds to transforming growth factor alpha (TGF-alpha). It is commonly used in various research applications, including studies on breast cancer cells (such as MCF-7), intraocular diseases, and TGF-beta signaling pathways. This antibody can be used for immunohistochemistry, immunofluorescence, western blotting, and other techniques to detect and quantify the presence of TGF-alpha in biological samples.</p>

<p>UBE2L6 antibody was raised using the N terminal of UBE2L6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL</p>

<p>Rabbit polyclonal DNA Polymerase zeta antibody</p>

<p>The NEK6 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets NEK6, a protein kinase involved in cell cycle regulation and cellular processes. This antibody has been widely used in studies related to collagen synthesis, electrode development, and the identification of inhibitory factors. It has also shown cytotoxic effects on certain cancer cells and has been used as a growth factor in cell culture experiments. Additionally, the NEK6 antibody can be used for the detection and quantification of NEK6 in various biological samples such as pleural fluid, human serum, and other body fluids. Its high specificity and affinity make it a valuable tool for researchers studying biomolecules, binding proteins, glutamate signaling pathways, chemokine receptors, and other related areas of research.</p>

<p>The HDAC10 antibody is a highly specific polyclonal antibody that targets the protein HDAC10. It can be used in various life science applications, including research and diagnostics. This antibody is produced using human monoclonal antibodies, ensuring high specificity and sensitivity.</p>

<p>The MBP antibody is a monoclonal antibody that targets β-catenin, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of β-catenin. It can be used for immunohistochemistry, western blotting, and other experimental techniques.</p>

<p>The NOX2 Antibody is a highly specialized monoclonal antibody that targets thrombocytopenia, a condition characterized by low platelet count. This antibody specifically binds to the insulin-like growth factor receptor (IGF-1R) on platelets, leading to their activation and increased production of dopamine and tyrosine hydroxylase. As a result, the NOX2 Antibody promotes platelet survival and proliferation, thereby improving overall blood clotting function. In addition to its therapeutic applications in treating thrombocytopenia, this antibody has also shown cytotoxic effects against certain cancer cells by targeting specific antigens such as alpha-synuclein. Its potential use in oncology research makes it a valuable tool for scientists in the field of Life Sciences. With its unique mechanism of action and proven efficacy, the NOX2 Antibody represents a promising advancement in the development of targeted therapies for various disorders and diseases.</p>

<p>alpha 6 Integrin antibody was raised in rat using Mouse mammary tumor cells as the immunogen.</p>

<p>The DNAJC7 antibody is a powerful tool in the field of Life Sciences. It is an isothiocyanate-conjugated polyclonal antibody that targets DNAJC7, a protein involved in various cellular processes. This antibody has been extensively used in research to study the role of DNAJC7 in insulin signaling, lipoprotein lipase activity, and heparin-induced thrombocytopenia. Additionally, it has been employed in studies investigating the effects of DNAJC7 on growth factors such as trastuzumab and epidermal growth factor. The DNAJC7 antibody offers researchers a valuable tool for understanding the function and regulation of this important glycoprotein. Whether you are studying inhibitors or monoclonal antibodies, this highly specific antibody will provide reliable results for your experiments.</p>

<p>The STMN1 antibody is a cyclase-activating and neutralizing monoclonal antibody. It is a biomolecule that specifically targets STMN1, a protein involved in cell cycle regulation and microtubule dynamics. This monoclonal antibody is produced using advanced techniques in the field of Life Sciences and is formulated with high-quality excipients to ensure stability and efficacy.</p>

<p>EEF1D antibody was raised in Rabbit using Human EEF1D as the immunogen</p>

<p>Rabbit polyclonal Transferrin antibody (HRP)</p>

<p>Rabbit polyclonal PLCD1 antibody</p>

<p>Mouse monoclonal NAPEPLD antibody</p>

<p>Purified Rabbit polyclonal MPK4 antibody</p>

<p>Purified Polyclonal RAB36 antibody</p>

<p>Rabbit polyclonal ZNF396 antibody</p>

<p>The TUB antibody is a monoclonal antibody that specifically targets the nuclear protein known as TUB. This antibody has been extensively tested and is proven to be highly effective in detecting TUB in human serum and MCF-7 cells. TUB is a crucial protein involved in various cellular processes, including hormone peptide synthesis, glucagon regulation, and tyrosine metabolism. Additionally, this antibody can be used in research applications such as immunohistochemistry and western blotting. Its high specificity and sensitivity make it a valuable tool for studying TUB-related diseases and exploring potential therapeutic interventions. Furthermore, the TUB antibody can be used in combination with other antibodies, such as anti-CD20 antibodies or alpha-fetoprotein antibodies, to enhance its detection capabilities. With its wide range of applications and reliable performance, the TUB antibody is an essential tool for researchers studying proteins involved in cellular signaling pathways, glycoprotein synthesis, amyloid plaque formation, and chemokine regulation.</p>

<p>The VEGFR2 antibody is a highly effective inhibitor that targets caspase-9 and anti-dnp antibodies. It is widely used in Life Sciences for its ability to block the growth factor and globulin responsible for angiogenesis. This powerful antibody has been shown to neutralize interferon and TNF-α, leading to the lysis of targeted cells. With its cytotoxic properties, it specifically targets endothelial growth, making it an ideal choice for antiangiogenic therapy. The VEGFR2 antibody is available as Polyclonal Antibodies, ensuring a high level of specificity and effectiveness in research and medical applications.</p>

<p>Mouse monoclonal GBP2 antibody</p>

<p>Affinity purified Rabbit polyclonal SEPT7 antibody</p>

<p>Rabbit Polyclonal GSK3 alpha antibody</p>

<p>RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT</p>

<p>CHD4 antibody was raised in Rabbit using Human CHD4 as the immunogen</p>

<p>KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids EDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELEN</p>

<p>Mouse monoclonal TBC1D21 antibody</p>

<p>Rabbit Polyclonal p53 antibody (Ser33)</p>

<p>Mouse IgE antibody was raised in rat using murine IgE as the immunogen.</p>

<p>The REG4 antibody is a highly specialized monoclonal antibody that targets the REG4 protein. This antibody complex has been shown to neutralize the activity of REG4, which plays a crucial role in various biological processes. It has been observed that REG4 promotes the production of interleukin-6 (IL-6), a pro-inflammatory cytokine, and stimulates lipid peroxidation in cells.</p>

<p>Albumin antibody was raised in Mouse using Human sera albumin as the immunogen.</p>

<p>NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL</p>

<p>Purified Rabbit polyclonal MYB53 antibody</p>

<p>The E Cadherin antibody is a monoclonal antibody that specifically targets E Cadherin, a protein involved in cell adhesion. This antibody is widely used in the field of Life Sciences for research purposes. It can be used to study various cellular processes, including chemokine signaling, growth factor regulation, and histone deacetylase inhibitors. The E Cadherin antibody has also been shown to be effective in inhibiting the activity of TGF-beta, a potent growth factor involved in cell proliferation and differentiation. Additionally, this antibody has been used in studies investigating the effects of drugs such as imatinib, ketorolac, and gabapentin on cellular processes. With its high specificity and potency, the E Cadherin antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>ETV4 antibody was raised in Rabbit using Human ETV4 as the immunogen</p>