Anticuerpos primarios

<p>Purified Rabbit polyclonal PR10a antibody</p>

<p>Mouse monoclonal MTRF1L antibody</p>

<p>Rabbit polyclonal GRIN2A antibody</p>

<p>Affinity purified Rabbit polyclonal PPFIBP2 antibody</p>

<p>The DDB1 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to DDB1, a protein involved in various cellular processes. This antibody is commonly used in hybridization experiments and immunohistochemistry studies to detect the presence and localization of DDB1 in different tissues and cell types. The DDB1 antibody has also been shown to have cytotoxic effects on human hepatocytes, making it a valuable tool for studying the role of DDB1 in liver diseases. Additionally, this antibody can be used in combination with other antibodies or growth factors to investigate the interactions between DDB1 and other proteins or signaling pathways. Whether you are conducting basic research or developing new therapeutic strategies, the DDB1 antibody is an essential tool for understanding the functions of this important protein.</p>

<p>Purified Polyclonal PKC theta antibody</p>

<p>Rabbit polyclonal UBXN11 antibody</p>

<p>Clostridium difficile toxin B antibody is a diagnostic agent used in immunochemical studies. It is a monoclonal antibody that specifically binds to Clostridium difficile toxin B, a cytosolic protein produced by the bacteria. This antibody has high affinity and specificity for the toxin, making it an effective tool for detecting and studying the presence of C. difficile infection. In addition to its use in research, this monoclonal antibody can also be used in clinical settings for the detection and diagnosis of C. difficile-associated diseases. Its ability to bind to the toxin makes it a valuable tool in identifying and monitoring C. difficile infections and their associated complications.</p>

<p>The alpha Synuclein antibody is a powerful tool in the field of Life Sciences. It specifically targets alpha-synuclein, a protein that plays a crucial role in neurodegenerative disorders such as Parkinson's disease. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>CPS1 antibody was raised using the middle region of CPS1 corresponding to a region with amino acids YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI</p>

<p>C17ORF48 antibody was raised using the N terminal Of C17Orf48 corresponding to a region with amino acids MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL</p>

<p>The TIE2 antibody is a monoclonal antibody that targets the growth factor receptor TIE2. This receptor plays a crucial role in regulating angiogenesis and vascular endothelial cell function. By binding to TIE2, the antibody blocks the activation of downstream signaling pathways, inhibiting tumor growth and metastasis.</p>

<p>BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL</p>

<p>GM-CSF antibody (biotin) was raised in rabbit using highly pure recombinant human GM-CSF as the immunogen.</p>

<p>The CD98 antibody is a monoclonal antibody that targets the CD98 protein, which is involved in various biological processes. This antibody acts as an inhibitor of CD98, preventing its interaction with other molecules such as chemokines. It has been shown to have neutralizing properties and can block the activity of CD98 in cardiomyocytes. Additionally, this antibody has been used in research to study the role of CD98 in different signaling pathways and cellular functions. It is commonly used in life sciences research and has been shown to interact with other proteins such as alpha-fetoprotein, β-catenin, and vitamin D-binding protein. The CD98 antibody is highly specific and effective for studying the glycosylation status of CD98 and its impact on cellular processes.</p>

<p>MAP2K2 antibody was raised using the C terminal of MAP2K2 corresponding to a region with amino acids IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV</p>

<p>Rabbit polyclonal ERP29 antibody (HRP)</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>ITPKB antibody was raised in Rabbit using Human ITPKB as the immunogen</p>

<p>Rabbit polyclonal SUPT16H antibody</p>

<p>The GIPR antibody is a powerful tool in the field of Life Sciences. It is designed to target and bind to specific proteins, such as myostatin, hemoglobin, fibrinogen, circumsporozoite protein, natriuretic peptides, elastase protein, and α-synuclein. The GIPR antibody comes in both polyclonal and monoclonal forms, allowing for a wide range of applications.</p>

<p>The SARS antibody is a monoclonal antibody that specifically targets the SARS-CoV-2 virus. It is designed to neutralize the virus and prevent it from infecting human cells. This antibody has been extensively studied and shown to have high affinity and specificity for the target molecule. It can be used in various immunoassays, such as ELISA or Western blot, to detect the presence of SARS-CoV-2 in patient samples. Additionally, this antibody has potential therapeutic applications and can be used to develop treatments for COVID-19. Its ability to neutralize the virus and inhibit its replication makes it a promising candidate for further research in the field of Life Sciences.</p>

<p>Mouse monoclonal GPHN antibody</p>

<p>Purified Polyclonal hOCT2 antibody</p>

<p>The FOXP1 antibody is a highly effective and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP1 protein, which plays a crucial role in various cellular processes. This antibody binds to the nuclear-activated FOXP1 protein, allowing for its detection and analysis.</p>

<p>PAFAH1B2 antibody was raised using the N terminal of PAFAH1B2 corresponding to a region with amino acids MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV</p>

<p>NR1D1 antibody was raised using the middle region of NR1D1 corresponding to a region with amino acids SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA</p>

<p>SF3B3 antibody was raised using the middle region of SF3B3 corresponding to a region with amino acids EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT</p>

<p>MAD2L1 antibody was raised in rabbit using the middle region of MAD2L1 as the immunogen</p>

<p>NSE antibody was raised in mouse using NSE from the human brain as the immunogen.</p>

<p>The ACSS2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of ACSS2, an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to have high affinity and specificity for ACSS2.</p>

<p>MTM1 antibody was raised in Rabbit using Human MTM1 as the immunogen</p>

<p>The FZD10 antibody is a monoclonal antibody that specifically targets the Frizzled-10 (FZD10) protein. It is composed of amino acid residues and contains a disulfide bond for stability. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal EIF2C1 antibody</p>

<p>Rabbit polyclonal MPRG antibody</p>

<p>KIF20A antibody was raised in rabbit using the middle region of KIF20A as the immunogen</p>

<p>Rabbit polyclonal TAF7 antibody</p>

<p>TC2N antibody was raised using the middle region of TC2N corresponding to a region with amino acids SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ</p>

<p>Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser106)</p>

<p>Rabbit polyclonal Actin alpha 2/3 antibody</p>

<p>The API5 antibody is an extracellular aminoacyl adeno-associated antibody that acts as an inhibitor. It is commonly used as a serum marker in the field of Life Sciences. This antibody has shown the potential to inhibit heparin cofactor activity and has been found to bind to serotonin, making it a valuable tool for studying the role of serotonin in various biological processes. Additionally, the API5 antibody can be used in the development of new medicines and is often utilized in research involving Polyclonal Antibodies. Its inhibitory properties make it a promising candidate for further investigation, particularly in combination with other inhibitors such as meayamycin. Moreover, this antibody has also been associated with autoantibodies, opening up avenues for exploring its potential role in autoimmune disorders.</p>

<p>AKT3 antibody was raised in Rabbit using Human AKT3 as the immunogen</p>

<p>XBP1 antibody was raised in Mouse using a purified recombinant fragment of human XBP1 expressed in E. coli as the immunogen.</p>

<p>HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD</p>

<p>The SUV39H2 antibody is a high-quality polyclonal antibody that specifically targets the human protein SUV39H2. It can also be used in an antigen-antibody reaction to detect and measure the expression of SUV39H2 in various biological samples, such as granulosa cells. This antibody recognizes a unique amino-acid sequence in SUV39H2 and has been extensively validated for its specificity and sensitivity.</p>

<p>The KLF11 antibody is a histidine monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has cytotoxic effects on cancer cells and has been shown to inhibit the growth of tumors in preclinical studies. Additionally, the KLF11 antibody has inhibitory properties against epidermal growth factor (EGF) and diacylglycerol (DAG), both of which play important roles in cellular processes. This antibody can be used in various applications within the life sciences field, including research and diagnostics. It is a valuable tool for studying signal transduction pathways and developing new therapeutic strategies for cancer treatment.</p>

<p>The DSG1 antibody is a highly specialized monoclonal antibody that has been activated to target and neutralize the growth factor known as HER2. This antibody is designed to specifically bind to the HER2 receptor, inhibiting its function and preventing the activation of downstream signaling pathways. By blocking HER2, the DSG1 antibody effectively halts the growth and proliferation of cancer cells that rely on this receptor for survival. In addition, this antibody has shown promising results in treating multidrug-resistant tumors, making it a valuable tool in the fight against cancer. With its unique amino group and carbonyl group structure, the DSG1 antibody exhibits high affinity and specificity for HER2, ensuring potent and targeted therapy. Trust in this cutting-edge antibody to deliver life-saving results in the field of oncology.</p>

<p>The Rb antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be an invaluable tool in studying different cellular pathways. This monoclonal antibody specifically targets the Rb protein, which is involved in regulating cell growth and division. By binding to the Rb protein, this antibody allows researchers to study its function and explore its potential as a therapeutic target.</p>

<p>The E2F1 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to the E2F1 protein, which is involved in cell cycle regulation and apoptosis. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The E2F1 antibody has been shown to be effective in detecting the activation of tumor necrosis factor-alpha (TNF-α) and beta-catenin signaling pathways. It can also be used to study adipose tissue development and function. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying various cellular processes and signaling pathways.</p>

<p>HCII antibody was raised in goat using human HCII purified from plasma as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal PHKA1 antibody</p>

<p>Rabbit polyclonal ERD22 antibody</p>

<p>Cyclin D-Type Binding-Protein 1 antibody was raised using the middle region of CCNDBP1 corresponding to a region with amino acids KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN</p>

<p>The TRIM59 antibody is a highly specific monoclonal antibody that targets the colony-stimulating factor (CSF) receptor. It plays a vital role in regulating cell growth, differentiation, and survival. This antibody binds to the CSF receptor with high affinity, leading to the activation of downstream signaling pathways involved in cell proliferation and survival.</p>

<p>Nestin Monoclonal Antibody (FITC)</p>

<p>The PDX1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitory factor, targeting specific growth factors and phosphatases to regulate cellular processes. This antibody has been extensively studied and proven effective in various research applications.</p>

<p>The CD54 antibody is a monoclonal antibody used in Life Sciences research. It is designed to target and bind to the CD54 protein, also known as intercellular adhesion molecule-1 (ICAM-1). This protein plays a crucial role in cell-cell adhesion and is involved in various physiological processes such as immune response and inflammation.</p>

<p>Rabbit Polyclonal CHST6 antibody</p>

<p>Rabbit polyclonal PLSCR4 antibody</p>

<p>PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA</p>

<p>The SEMA4A antibody is a polyclonal antibody that specifically targets the protein SEMA4A, which belongs to the family of costimulatory molecules. This antibody can be used in various life sciences applications, including immunomodulatory research and dendritic cell studies. By binding to SEMA4A, this antibody can inhibit its interaction with membrane-bound receptors, thereby modulating immune responses. The SEMA4A antibody is a valuable tool for researchers studying the role of costimulatory molecules in immune regulation and developing novel immunotherapies.</p>

<p>Rabbit polyclonal RPL36 antibody</p>

<p>Rabbit Polyclonal GIMAP4 antibody</p>

<p>Rabbit polyclonal AZI1 antibody</p>

<p>Rabbit polyclonal MYF6 antibody</p>

<p>LRCH3 antibody was raised in Rabbit using Human LRCH3 as the immunogen</p>

<p>CNDP1 antibody was raised in rabbit using the C terminal of CNDP1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal HSD17B1 antibody</p>

<p>DAAM1 antibody was raised in Rabbit using Human DAAM1 as the immunogen</p>

<p>EIF2A antibody was raised using the C terminal of EIF2A corresponding to a region with amino acids DKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNLKKKLKAIEQLKEQ</p>

<p>Rabbit polyclonal PLLP antibody</p>

<p>APH1A antibody was raised in Rabbit using Human APH1A as the immunogen</p>

<p>BMP2K antibody was raised using the middle region of BMP2K corresponding to a region with amino acids VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD</p>

<p>IL1a antibody was raised in rabbit using highly pure recombinant murine IL-1a as the immunogen.</p>

<p>Rabbit polyclonal PSMB3 antibody</p>

<p>The Annexin A2 antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in various biological processes, including interferon signaling, glutamate release, and the regulation of TNF-α and growth factor binding proteins. This polyclonal antibody is specifically designed to neutralize Annexin A2 activity and has been extensively tested for its efficacy in human serum. It can be used in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA assays. Additionally, monoclonal antibodies targeting Annexin A2 are also available for more specific research needs. With its high specificity and affinity, this antibody is an essential tool for researchers studying the functions of Annexin A2 in cellular processes and disease mechanisms.</p>

<p>The HA Tag antibody is a highly sought-after product in the field of Life Sciences. This monoclonal antibody is specifically designed to target and bind to the HA (hemagglutinin) tag, a small peptide sequence that is commonly added to proteins for various research purposes.</p>

<p>IL6 antibody was raised in mouse using recombinant human IL-6 as the immunogen.</p>

<p>Rabbit polyclonal REEP2 antibody</p>

<p>Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE</p>

<p>EPHA2 antibody was raised in Rabbit using Human EPHA2 as the immunogen</p>

<p>The SP6 antibody is a monoclonal antibody widely used in the field of Life Sciences. It specifically targets androgen receptors, which play a crucial role in various biological processes. By inhibiting the binding of androgens to their receptors, the SP6 antibody effectively blocks downstream signaling pathways.</p>

<p>Purified Rabbit polyclonal ESD antibody</p>

<p>HELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD</p>

<p>Rabbit polyclonal metC antibody (FITC)</p>

<p>Mouse monoclonal ACOT12 antibody</p>

<p>Rabbit polyclonal CATC antibody</p>

<p>PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE</p>

<p>Purified Polyclonal RPS17 antibody</p>

<p>The CDC2 antibody is a reactive, non-phosphorylated monoclonal antibody that is commonly used in Life Sciences research. It is produced by hybridoma cells and specifically targets the CDC2 protein kinase. This antibody is widely used as a tool for studying cell cycle regulation and protein phosphorylation. It can be used in various applications such as immunoblotting, immunoprecipitation, and immunofluorescence. The CDC2 antibody is also useful for detecting autoantibodies in patient samples and has been implicated in certain autoimmune disorders. Additionally, this antibody can be immobilized on cellulose or other solid supports to generate protein inhibitors for use in biochemical assays. Overall, the CDC2 antibody is a valuable tool for researchers studying cell cycle control, protein phosphorylation, and related areas of biology.</p>

<p>Ankyrin 1 antibody was raised using the C terminal of ANK1 corresponding to a region with amino acids VVRQIDLSSADAAQEHEEVELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ</p>

<p>KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL</p>

<p>Rabbit polyclonal RAB9A antibody</p>

<p>The TRAF7 antibody is a powerful antiviral tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes TRAF7, an important protein involved in interferon signaling pathways. This antibody has been extensively studied and proven to effectively block the activity of TRAF7, thereby inhibiting viral replication and spread.</p>

<p>Rabbit polyclonal TF3C4 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections, making it an essential compound in the fight against this disease. With its bactericidal activity, it effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes, confirming its high efficacy. Furthermore, it undergoes various metabolic transformations, ensuring optimal effectiveness through hydrolysis, oxidation, reduction, and conjugation processes. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its potency by inhibiting cell growth. Choose 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for a reliable and effective solution against tuberculosis infections.</p>

<p>Purified Polyclonal Alpha crystallin B antibody</p>

<p>The hnRNP A1 Antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and can be easily utilized in various immunoassays. This antibody specifically targets hnRNP A1, a crucial protein involved in multiple cellular processes.</p>

<p>ARHGAP30 antibody was raised using the N terminal of ARHGAP30 corresponding to a region with amino acids RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG</p>

<p>MLC1 antibody was raised using the middle region of MLC1 corresponding to a region with amino acids SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL</p>