Anticuerpos primarios

<p>IGF1R antibody was raised in Mouse using a purified recombinant fragment of IGF1R expressed in E. coli as the immunogen.</p>

<p>DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK</p>

<p>Mouse monoclonal PSMD2 antibody</p>

<p>Mouse monoclonal FceRI alpha antibody</p>

<p>Purified Polyclonal RPL11 antibody</p>

<p>Mouse anti Human IgG antibody was raised in Mouse using Human IgG was isolated from human sera and purified by chromatography as the immunogen.</p>

<p>CLASP1 antibody was raised in Rat using alpha-CLASP1-N-terminus and GST fusion protein as the immunogen.</p>

<p>Tropomyosin 3 antibody was raised using the middle region of TPM3 corresponding to a region with amino acids TEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKIL</p>

<p>C12ORF4 antibody was raised using the N terminal Of C12Orf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS</p>

<p>Goat anti Mouse Lambda Light Chain secondary antibody (HRP)</p>

<p>ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA</p>

<p>The OR51E1 antibody is a highly effective neutralizing agent used in Life Sciences research. It has been extensively tested and validated through electrophoresis techniques. This antibody specifically targets e-cadherin, fibrinogen, erythropoietin, chemokine, collagen, interleukin-6, and actin.</p>

<p>The HER2 antibody is a highly effective medicament that acts as an anti-HER2 antibody. It works by targeting the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. This biochemical agent belongs to the class of monoclonal antibodies, similar to adalimumab and trastuzumab. The HER2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting tumor growth.</p>

<p>The YAP antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects the Yes-associated protein (YAP). YAP is an important growth factor involved in various cellular processes, including cell proliferation and differentiation.</p>

<p>Purified Rabbit polyclonal OR4L1 antibody</p>

<p>METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS</p>

<p>MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR</p>

<p>Mouse monoclonal Toll-like receptor 2 antibody (biotin)</p>

<p>ALDH3B2 antibody was raised in Rabbit using Human ALDH3B2 as the immunogen</p>

<p>Rabbit polyclonal PAK4/5/6 antibody</p>

<p>CYP27C1 antibody was raised using the middle region of CYP27C1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL</p>

<p>Perforin antibody was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.</p>

<p>NUP62 antibody was raised using the N terminal of NUP62 corresponding to a region with amino acids SGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPA</p>

<p>The PEA15 antibody is a polyclonal antibody that specifically targets interleukin-6 (IL-6), an inflammatory cytokine involved in various physiological processes. This antibody acts as an inhibitory factor for IL-6, preventing its activation and downstream signaling pathways. Additionally, the PEA15 antibody has been shown to have neutralizing effects on other proteins, such as epidermal growth factor (EGF) and glycine.</p>

<p>The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.</p>

<p>FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR</p>

<p>CRH antibody was raised in Rabbit using Human CRH as the immunogen</p>

<p>Rabbit polyclonal TUSC4 antibody</p>

<p>The BRaf antibody is a highly specific antibody used in various life science applications. It is commonly used to detect and measure the levels of BRaf protein in samples. This antibody has been extensively validated and shown to have high affinity and specificity for BRaf.</p>

<p>The IRAK1 antibody is a high-quality polyclonal antibody that specifically targets and binds to interleukin-1 receptor-associated kinase 1 (IRAK1). This antibody is crucial in life sciences research as it plays a vital role in the innate immune response. It has been extensively used to study the signaling pathways involved in inflammatory responses and autoimmune diseases.</p>

<p>The Progesterone Receptor antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the progesterone receptor, a protein involved in various physiological processes. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which makes it useful for studying angiogenesis and tumor growth. In addition, it has been used to detect the presence of the progesterone receptor in various cell types, including MCF-7 breast cancer cells. The Progesterone Receptor antibody is activated by binding to its target protein and can be used in a variety of assays, such as ELISA or immunohistochemistry. Its high specificity and affinity make it an essential tool for researchers studying hormone signaling pathways and related diseases.</p>

<p>Rat monoclonal CD4 antibody (PE); mouse target; IgG2b kappa; clone GK1.5</p>

<p>ATP5B antibody was raised using the C terminal of ATP5B corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>EPCAM antibody was raised in Rabbit using Human EPCAM as the immunogen</p>

<p>Rabbit polyclonal CRGF antibody (FITC)</p>

<p>Rabbit Polyclonal Cyclin B1 antibody (Ser147)</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ</p>

<p>Purified Polyclonal HCCS antibody</p>

<p>Affinity purified Rabbit polyclonal Cytokeratin 2 antibody</p>

<p>Rabbit polyclonal NFKB1 antibody (HRP)</p>

<p>MDM4 antibody was raised in rabbit using the N terminal of MDM4 as the immunogen</p>

<p>Transferrin antibody (Texas Red) was raised in rabbit using human transferrin as the immunogen.</p>

<p>Mouse monoclonal CD4 antibody (FITC); human immunogen; IgG1 kappa; clone RPA-T4</p>

<p>INTS10 antibody was raised in Rabbit using Human INTS10 as the immunogen</p>

<p>Rabbit polyclonal PDSS2 antibody</p>

<p>Purified Polyclonal Frizzled 6 antibody</p>

<p>Rabbit polyclonal CAF1A antibody</p>

<p>Purified Polyclonal NCKX2 antibody</p>

<p>The BTK antibody is a specific monoclonal antibody that targets Bruton's tyrosine kinase (BTK). It is commonly used in the field of Life Sciences for research purposes. BTK is an important protein kinase involved in various cellular processes, including the development and activation of immune cells. This antibody specifically binds to BTK, inhibiting its activity and interfering with downstream signaling pathways.</p>

<p>DOK2 antibody was raised in rabbit using the C terminal of DOK2 as the immunogen</p>

<p>Purified Rabbit polyclonal MADS50 antibody</p>

<p>Purified Polyclonal Complement C1R LC antibody</p>

<p>The CD80 antibody is a collagen-based monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the CD80 protein, which is an important immune checkpoint molecule involved in T-cell activation. The antibody has been shown to effectively block the interaction between CD80 and its receptor, leading to the inhibition of T-cell activation and proliferation.</p>

<p>Rabbit Polyclonal p53 antibody (Ser315)</p>

<p>Rabbit polyclonal SCUBE3 antibody</p>

<p>CA2 antibody was raised in Rabbit using Human CA2 as the immunogen</p>

<p>Rabbit Polyclonal POU2F1 antibody (Ser385)</p>

<p>The Keratin 8 antibody is a disulfide bond-based polyclonal antibody that specifically targets and detects the presence of Keratin 8. This antibody is commonly used in life sciences research, particularly in studies involving cell biology and molecular biology. It can be used for various applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.</p>

<p>Rabbit polyclonal TRADD antibody</p>

<p>HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE</p>

<p>FABP antibody is a growth factor that has been modified with colloidal acid to enhance its neutralizing properties. It specifically targets lipoprotein lipase and inhibits its activity, making it an effective tool in studying the role of lipoproteins in various biological processes. This antibody has undergone glycosylation, which improves its stability and bioavailability. FABP antibody is commonly used in Life Sciences research, particularly in studies involving interferon and monoclonal antibodies. It can be immobilized on cellulose for purification purposes or used as a detection tool in assays. Whether you need a monoclonal or polyclonal antibody, FABP antibody is a valuable tool for your research needs.</p>

<p>SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA</p>

<p>CD40 antibody (Azide free) was raised in rat using CD40 as the immunogen</p>

<p>DGCR2 antibody was raised in Rabbit using Human DGCR2 as the immunogen</p>

<p>PPP1R13L antibody was raised in mouse using recombinant Human Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 13 Like (Ppp1R13L)</p>

<p>Rabbit polyclonal PGM2L1 antibody</p>

<p>MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL</p>

<p>The Aldolase antibody is a highly specialized protein used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets various proteins, including caspase-9, endonuclease, and β-catenin, among others.</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>The ITGB4 antibody is a highly specialized biomolecule that acts as an inhibitor of growth factors. It specifically targets nuclear and nucleotide molecules, preventing them from activating certain cellular processes. This monoclonal antibody has been shown to have a high affinity for the tyrosine residues on the surface of cells, effectively blocking their interaction with growth factor receptors.</p>

<p>ERCC5 antibody was raised in Rabbit using Human ERCC5 as the immunogen</p>

<p>Rabbit polyclonal AQP12 antibody</p>

<p>FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST</p>

<p>Mouse monoclonal PPARA antibody</p>

<p>CYP27A1 antibody was raised in Rabbit using Human CYP27A1 as the immunogen</p>

<p>MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ</p>

<p>CCBL1 antibody was raised in Rabbit using Human CCBL1 as the immunogen</p>

<p>Rabbit polyclonal EIF3S2 antibody</p>

<p>The Chk2 antibody is a highly specific antibody that is used in Life Sciences research to detect and study the Chk2 protein. This protein plays a crucial role in cell cycle regulation and DNA damage response. The Chk2 antibody is generated using high-quality monoclonal or polyclonal antibodies, ensuring accurate and reliable results.</p>

<p>Rabbit polyclonal RPL9 antibody</p>

<p>The ROCK2 antibody is a protein that has neutralizing properties against collagen. It belongs to the class of polyclonal antibodies and is used in Life Sciences research. This antibody specifically targets ROCK2, which stands for Rho-associated coiled-coil containing protein kinase 2. ROCK2 is involved in various cellular processes, including cell proliferation, migration, and contraction. The ROCK2 antibody can be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). It is available in both monoclonal and polyclonal forms. The antibody can be immobilized on chromatographic resins or used for protein-protein interaction studies. Additionally, it can be used to study the role of ROCK2 in hepatocyte growth factor signaling pathways or to investigate its binding partners such as angptl3 or growth factor binding proteins.</p>

<p>Rabbit polyclonal TNFAIP8 antibody</p>

<p>Purified Polyclonal Cytochrome P450 3A4 antibody</p>

<p>CTDSP2 antibody was raised in Rabbit using Human CTDSP2 as the immunogen</p>

<p>Rabbit polyclonal Goat Serum Albumin antibody (HRP)</p>

<p>DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF</p>

<p>Rabbit Polyclonal p62Dok antibody (Tyr362)</p>

<p>Mouse monoclonal TUBAL3 antibody</p>

<p>Rabbit polyclonal UBASH3A antibody</p>

<p>The ND2 antibody is a highly specialized antibody that targets specific growth factors in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The ND2 antibody has been extensively studied for its ability to detect glycosylation patterns and identify key molecules involved in cellular processes.</p>

<p>Rabbit polyclonal NFkB p100 antibody (Ser872)</p>

<p>The CD90.2 antibody is a highly sensitive fluorescent probe that is used for ultrasensitive detection in various applications. It is a monoclonal antibody that specifically targets the CD90.2 antigen, which is a cell surface marker found on various cell types, including immune cells and stem cells. This antibody can be used in research and diagnostic settings to detect the presence of CD90.2 in samples such as human serum or tissue sections.</p>

<p>EIF4ENIF1 antibody was raised in mouse using recombinant Human Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 (Eif4Enif1)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively tested using advanced techniques like the patch-clamp technique on human erythrocytes, confirming its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, ensuring effective utilization within the body. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains and inhibit cell growth, this drug is a valuable weapon against tuberculosis.</p>

<p>IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH</p>

<p>Mouse monoclonal CBWD1 antibody</p>

<p>Mouse monoclonal ELK3 antibody</p>