Anticuerpos primarios

<p>The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.</p>

<p>MNAT1 antibody was raised in Rabbit using Human MNAT1 as the immunogen</p>

<p>BRSK2 antibody was raised in Rabbit using Human BRSK2 as the immunogen</p>

<p>GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA</p>

<p>The GPR171 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to GPR171, a receptor protein involved in various physiological processes. This antibody has been extensively studied and proven to be effective in research related to fibrinogen, lipoprotein lipase, ketamine, histidine, TGF-beta, epidermal growth factor, carbamazepine, and many other important molecules and pathways.</p>

<p>ZCCHC17 antibody was raised using the middle region of ZCCHC17 corresponding to a region with amino acids CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH</p>

<p>DUS1L antibody was raised in Rabbit using Human DUS1L as the immunogen</p>

<p>Purified Polyclonal ABCA9 antibody</p>

<p>INVS antibody was raised in Rabbit using Human INVS as the immunogen</p>

<p>Purified Polyclonal DNA Polymerase alpha 1 antibody</p>

The Homer 3 antibody is a monoclonal antibody that has neutralizing properties against natriuretic, multidrug, growth factor, and hormone peptides. This antibody specifically targets collagen and inhibits its activity. It is widely used in the field of Life Sciences for research purposes. The Homer 3 antibody also plays a role in regulating triglyceride lipase and lipoprotein lipase activities. Additionally, it has been shown to have antibiotic properties against certain bacteria. With its high specificity and effectiveness, the Homer 3 antibody is an essential tool for researchers and scientists in various fields of study.

<p>Rabbit polyclonal CNPY2 antibody</p>

<p>EIF4B antibody was raised using the middle region of EIF4B corresponding to a region with amino acids QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS</p>

<p>NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG</p>

<p>CYP4F11 antibody was raised using the N terminal of CYP4F11 corresponding to a region with amino acids FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI</p>

<p>Rabbit polyclonal LAMA5 antibody</p>

<p>The S6K antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets transferrin, a protein involved in iron transport. This antibody can be used for various applications, such as immunohistochemistry and western blotting. It has been extensively tested and validated to ensure its specificity and sensitivity.</p>

TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV

<p>The CA 125 antibody is an immobilized monoclonal antibody that specifically targets the cell antigen CA 125. It has been extensively tested and validated for its high affinity and specificity towards CA 125. This antibody is commonly used in research and diagnostic applications to detect and quantify CA 125 levels in biological samples.</p>

<p>Rabbit polyclonal CHRM1 antibody</p>

<p>COQ7 antibody was raised in Rabbit using Human COQ7 as the immunogen</p>

<p>The GALR3 antibody is a high-quality reagent that belongs to the class of polyclonal antibodies. It specifically targets galanin receptors, which are protein products involved in various biological processes. This antibody is widely used in life sciences research to study the functions and interactions of galanin and its receptors. With its exceptional specificity and sensitivity, the GALR3 antibody is an essential tool for scientists working in the field of galanin receptor research. Whether you are investigating neurobiology, endocrinology, or other related areas, this antibody will provide valuable insights into the role of galanin receptors in various physiological processes. Trust the GALR3 antibody to deliver reliable and reproducible results for your experiments and advance your scientific understanding.</p>

<p>DUSP15 antibody was raised in Rabbit using Human DUSP15 as the immunogen</p>

<p>Purified Polyclonal LASS4 antibody</p>

<p>The Histone H1 antibody is a mouse monoclonal antibody that specifically targets histone H1, a protein involved in the packaging of DNA into chromatin. This antibody is widely used in Life Sciences research, particularly in the study of pluripotent stem cells and their differentiation. It can be used for various applications, including immunohistochemistry, Western blotting, and hybridization assays.</p>

<p>MED28 antibody was raised in Rabbit using Human MED28 as the immunogen</p>

NCOR2 antibody was raised in Rabbit using Human NCOR2 as the immunogen

<p>Rabbit polyclonal PLRG1 antibody</p>

<p>SNRPD2 antibody was raised using the N terminal of SNRPD2 corresponding to a region with amino acids MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK</p>

<p>C13orf18 antibody was raised in Rabbit using Human C13orf18 as the immunogen</p>

<p>Anti-Canine Corona Virus Antibody</p>

<p>CCS antibody was raised in rabbit using the middle region of CCS as the immunogen</p>

<p>The Nucleophosmin antibody is a highly specialized monoclonal antibody that targets the basic protein nucleophosmin. It has been shown to be activated in response to various stimuli, including glucagon and interferon. This antibody specifically binds to nucleophosmin, preventing its interaction with other molecules and inhibiting its function.</p>

<p>CLOCK antibody was raised in Mouse using a purified recombinant fragment of human CLOCK expressed in E. coli as the immunogen.</p>

<p>ACSF2 antibody was raised in rabbit using the C terminal of ACSF2 as the immunogen</p>

<p>CD40 antibody was raised in Mouse using a purified recombinant fragment of CD40 expressed in E. coli as the immunogen.</p>

<p>ESD antibody was raised in Rabbit using Human ESD as the immunogen</p>

<p>The SLC22A17 antibody is a powerful tool used in Life Sciences research for the detection and analysis of cxcl13, a nuclear antigen. This polyclonal antibody has been extensively tested and validated for various applications, including immunohistochemistry and DNA-binding protein studies. It specifically recognizes and binds to the surface glycoprotein expressed by SLC22A17, forming a specific complex that can be visualized using techniques such as impedance spectroscopy. With its high specificity and sensitivity, this monoclonal antibody is an essential component in any research project requiring the detection of SLC22A17. Trust in its reliability and accuracy to advance your scientific endeavors.</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Rabbit polyclonal MLTK antibody</p>

<p>The SOCS3 antibody is a vital tool in the field of Life Sciences. It is commonly used to study the effects of erythropoietin, an immunosuppressant and growth factor. This antibody specifically targets the suppressor of cytokine signaling 3 (SOCS3) protein, which plays a crucial role in regulating various cellular processes.</p>

<p>Mouse monoclonal HDHD2 antibody</p>

<p>The CDK1 antibody is a highly specialized antibody that targets the cyclin-dependent kinase 1 (CDK1), an important protein involved in cell cycle regulation. This antibody specifically recognizes and binds to CDK1, inhibiting its activity and preventing cell division. It has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>Rabbit Polyclonal HDAC5 antibody (Ser498)</p>

<p>The KPNA2 Antibody is a highly specialized peptide mimic that targets microvessel endothelial cells. It is designed to detect and bind to autoantibodies, making it an essential tool in the field of Life Sciences. This antibody is widely used in various industrial applications, including research on non-alcoholic steatohepatitis and biochemical studies involving protein kinases.</p>

<p>The KLF11 antibody is a basic protein that is widely used in Life Sciences research. It is an interferon-inducible protein that plays a crucial role in regulating gene expression. The KLF11 antibody has been extensively studied and has been found to be associated with various autoimmune diseases, including the production of autoantibodies and the regulation of IFN-gamma signaling. This monoclonal antibody is a valuable tool for researchers studying the function and activity of KLF11. It can be used as a test compound to investigate the effects of KLF11 inhibitors or other antibodies on cellular processes such as intraocular viscosity, chemokine production, acetylcholine release, and growth factor signaling. With its high specificity and affinity, the KLF11 antibody provides reliable results and contributes to advancing our understanding of important biological processes.</p>

<p>The CD40L antibody is a monoclonal antibody used in Life Sciences research. It acts as an inhibitory factor when activated and is commonly used in various assays and experiments. This antibody specifically targets CD40L, a protein involved in immune responses and cell signaling. The CD40L antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods.</p>

Rabbit polyclonal PI4KA antibody

<p>FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL</p>

<p>ASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids LVVICVTGSQSEGHRGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGS</p>

<p>Rabbit Polyclonal CDK6 antibody (Tyr13)</p>

<p>GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids FLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQ</p>

<p>Rabbit polyclonal MPZ antibody (HRP)</p>

<p>Mouse monoclonal Dengue Type 2 antibody</p>

<p>GEMIN4 antibody was raised in Rabbit using Human GEMIN4 as the immunogen</p>

<p>The STAT5A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and neutralizes the hepatocyte growth factor, making it a valuable tool for studying its role in various biological processes. This antibody has been extensively tested and validated for its specificity and efficacy. It can be used in a variety of applications, including Western blotting, immunoprecipitation, and immunofluorescence. The STAT5A antibody is produced using high-quality materials and is free from any harmful excipients. It recognizes the protein complex formed by STAT5A and other proteins, such as collagen and fibronectin. This antibody is an essential tool for researchers studying signal transduction pathways involving STAT5A and its downstream targets. Its high affinity and low background make it ideal for detecting even low levels of STAT5A in samples.</p>

<p>Purified Rabbit polyclonal HDAC7A antibody</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Purified Polyclonal ZNF187 antibody</p>

<p>FMN2 antibody was raised in Rabbit using Human FMN2 as the immunogen</p>

<p>COIL antibody was raised in Rabbit using Human COIL as the immunogen</p>

<p>Purified Polyclonal Microcephalin antibody</p>

<p>Rabbit polyclonal RRAGA antibody (biotin)</p>

<p>Rabbit polyclonal POLR1E antibody</p>

<p>Rabbit polyclonal CGRP antibody (HRP)</p>

<p>Rabbit polyclonal ASK1 antibody (Ser966)</p>

<p>The ATM antibody is a highly specialized monoclonal antibody that has been designed to target and bind to the ATM protein. This protein plays a crucial role in the DNA damage response pathway and is involved in cell cycle regulation, DNA repair, and apoptosis. The ATM antibody can be used in various research applications, including molecular docking studies, immunoassays, and hybridization experiments. It has been shown to specifically recognize and form a complex with the epidermal growth factor (EGF)-like domain of the ATM protein. Additionally, the ATM antibody exhibits high affinity for albumin, a major component of human serum. Its unique binding properties make it an invaluable tool for scientists working in the field of life sciences who are studying cellular processes related to DNA damage and repair.</p>

<p>Rabbit polyclonal IL1A antibody (FITC)</p>

<p>MYBBP1A antibody was raised in Rabbit using Human MYBBP1A as the immunogen</p>

<p>NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids  PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL</p>

<p>Mouse monoclonal CD172a antibody (allophycocyanin)</p>

<p>Mouse monoclonal MICAL1 antibody</p>

<p>Rabbit polyclonal UBC9 antibody (FITC)</p>

<p>Mouse monoclonal NEUROG1 antibody</p>

<p>Human Artemis internal region immunogen; rabbit polyclonal Artemis antibody</p>

WNT5A antibody was raised in Mouse using a purified recombinant fragment of WNT5A expressed in E. coli as the immunogen.

<p>The PIAS4 antibody is a highly specialized antibody that targets α-syn, an extracellular antigen involved in various growth factor signaling pathways. This antibody is part of the Polyclonal Antibodies family and is widely used in Life Sciences research. It has been shown to be effective in detecting α-syn expression and studying its role in different cellular processes.</p>

<p>The SAMHD1 antibody is a neuroprotective globulin that is used in the field of Life Sciences. It is a monoclonal antibody that targets SAMHD1, an inhibitory factor involved in various cellular processes. This antibody has been shown to neutralize the activity of SAMHD1 and has potential applications in research and therapeutic development. The SAMHD1 antibody is highly specific and exhibits high affinity for its target. It can be used in various assays, including immunohistochemistry, Western blotting, and flow cytometry. This product is available as a monoclonal antibody with excipients to ensure stability and long shelf life. The SAMHD1 antibody is glycosylated, which enhances its binding efficiency and overall performance. With its unique properties, this antibody offers great potential for advancing scientific discoveries in the field of neuroprotection and beyond.</p>

<p>The XIAP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to X-linked inhibitor of apoptosis protein (XIAP), a glycoprotein that plays a crucial role in cell survival and death pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>GBV-C virus glycoprotein E2 Monoclonal Antibody</p>

<p>EIF4A3 antibody was raised in Rabbit using Human EIF4A3 as the immunogen</p>

<p>The SP2 antibody is a monoclonal antibody that specifically binds to tyrosine residues on target proteins. It is commonly used in life sciences research to study the function and localization of these proteins. The SP2 antibody has been shown to interact with a variety of binding proteins, including β-catenin and glucagon. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and flow cytometry. Its high specificity and affinity make it an ideal tool for detecting and studying specific antigens in biological samples. Additionally, the SP2 antibody has been utilized in cytotoxic assays to deliver targeted therapies directly to cancer cells or other disease-related targets. Its ability to recognize specific epitopes makes it a valuable asset in understanding cellular processes at the molecular level.</p>

<p>Rabbit polyclonal CD249 antibody (FITC)</p>

<p>The PTGER1 antibody is a highly specialized polyclonal antibody that is designed to specifically target and bind to the PTGER1 antigen. This antibody is widely used in research and life sciences applications, particularly in the study of alpha-synuclein and its role in various diseases and conditions. The PTGER1 antibody has been shown to have a high affinity for the PTGER1 antigen, making it an ideal tool for detecting and quantifying the presence of this protein in samples. Additionally, this antibody has been extensively validated for use in techniques such as immunohistochemistry, immunofluorescence, and Western blotting. Its exceptional specificity ensures reliable and accurate results, making it an invaluable asset for researchers working in the fields of neuroscience, cell biology, and molecular biology. With its ability to provide detailed insights into the expression patterns and localization of PTGER1, this antibody opens up new avenues for understanding the complex mechanisms underlying various diseases and holds great promise for future therapeutic development.</p>

<p>Rabbit polyclonal CYB5 antibody</p>

<p>RICTOR antibody was raised in Mouse using a purified recombinant fragment of human RICTOR expressed in E. coli as the immunogen.</p>

<p>CTSL2 antibody was raised in Rabbit using Human CTSL2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal KPNA4 antibody</p>

<p>The ASS1 antibody is a growth factor monoclonal antibody that has antibiotic properties. It is designed to target specific molecules in cells, leading to cell cytotoxicity. This antibody is widely used in the field of Life Sciences for research purposes. It can be used in conjunction with other antibodies, such as polyclonal antibodies, to study various biological processes and pathways. The ASS1 antibody has been shown to have an inhibitory effect on chemokines and can also inhibit the activity of TGF-beta and endothelial growth factors. Additionally, it has cytotoxic effects on certain cells and has been found to enhance the efficacy of antibiotics like ethionamide. Furthermore, this antibody plays a role in collagen synthesis and regulation. With its diverse applications, the ASS1 antibody is a valuable tool for researchers in many fields of study.</p>

<p>BID antibody was raised in Rabbit using Human BID as the immunogen</p>

<p>Rabbit polyclonal FPRL2 antibody</p>

<p>KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG</p>

<p>alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids  VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD</p>

<p>Rabbit polyclonal PSMB4 antibody</p>

<p>SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS</p>

<p>The BAX antibody is a monoclonal antibody that specifically targets protein-protein interactions involving BAX. It is commonly used in research and pharmaceutical applications to study the role of BAX in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity, ensuring reliable results in experiments.</p>

<p>The RPS8 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the activity of RPS8, a protein involved in various cellular processes. This antibody has been extensively tested and proven to have high specificity and affinity for RPS8.</p>

<p>The NMDAR1 antibody is a monoclonal antibody that specifically targets the N-methyl-D-aspartate receptor subunit 1 (NMDAR1). This receptor plays a crucial role in synaptic plasticity and memory formation. The NMDAR1 antibody has been extensively studied in the field of neuroscience and has shown promising results in various applications.</p>

<p>Rabbit Polyclonal KCTD3 antibody</p>

<p>Rabbit polyclonal PDLIM5 antibody</p>