Anticuerpos primarios

<p>Rabbit Polyclonal IKK alpha antibody (Ser180/181)</p>

<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE</p>

<p>Rabbit polyclonal ERH antibody (biotin)</p>

<p>The GluR4 antibody is a monoclonal antibody that specifically targets the GluR4 protein, which is a subtype of glutamate receptor. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been used to detect and quantify the expression levels of GluR4 in human serum samples, as well as in different cell types.</p>

<p>The RAD9 antibody is a trifunctional antibody that plays a crucial role in various life sciences applications. It is widely used in research to study the signaling pathways of growth factors and 3-kinase enzymes. This polyclonal antibody specifically targets the RAD9 protein, which is activated in response to genotoxic stress and DNA damage. It has been shown to have neutralizing effects on amyloid proteins and can be used to detect and quantify alpha-fetoprotein levels in human serum samples. The RAD9 antibody is also commonly utilized in immunohistochemistry and Western blotting techniques, making it an essential tool for researchers studying protein kinases, chemokines, and other molecular markers. With its high specificity and sensitivity, this antibody provides reliable results for a wide range of experimental applications in the field of Life Sciences.</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>The ZFP36 antibody is a substance that acts as an inhibitor and belongs to the class of monoclonal antibodies. It has been used in the field of medicine and life sciences for various applications. The ZFP36 antibody has shown potential as an HDAC inhibitor, which means it can inhibit the activity of histone deacetylases. This inhibition can lead to changes in gene expression and cellular processes.</p>

<p>Rabbit Polyclonal NMDAR2B antibody (Tyr1474)</p>

<p>The CD102 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been shown to be effective in detecting β-catenin expression in various tissues, including liver microsomes. Additionally, the CD102 antibody has anti-beta amyloid properties, making it useful for studying neurodegenerative diseases such as Alzheimer's. It also exhibits growth factor activity and can activate caspase-9, an enzyme involved in apoptosis. This antibody has antiviral properties and can inhibit the replication of certain viruses. The CD102 antibody is commonly used in immunoassays to detect the presence of β-catenin and can also be used to study polymerase activity and proteolytic processes. Its acidic nature allows for optimal binding to nuclear factor kappa-light-chain-enhancer regions.</p>

<p>The JAK3 antibody is a monoclonal antibody that specifically targets the activated form of the JAK3 protein. This antibody is commonly used in research and diagnostic applications to detect and quantify the presence of JAK3 in human serum samples. The JAK3 antibody can be immobilized on an electrode or colloidal surface to create a sensitive and specific assay for detecting JAK3 levels. It is also used in studies investigating growth factors, autoantibodies, and collagen-related diseases. The high specificity and affinity of this monoclonal antibody make it an essential tool for researchers studying helicobacter infections and other diseases involving the JAK3 pathway. Additionally, the JAK3 antibody can be used in combination with other antibodies, such as polyclonal antibodies, to enhance detection sensitivity and accuracy.</p>

<p>The GluR1 antibody is a polyclonal antibody that is used in Life Sciences research. It has been specifically designed to detect and bind to the GluR1 receptor, which is an ionotropic glutamate receptor involved in synaptic transmission. This antibody can be used in various applications, such as electrochemical impedance spectroscopy and transcription-polymerase chain reaction (PCR), to study the function and expression of the GluR1 receptor. Additionally, it can be used in agglutination assays to measure the interaction between the GluR1 receptor and other molecules, such as glycine or gamma-aminobutyric acid (GABA). The GluR1 antibody has high specificity and affinity for its target, making it a valuable tool for researchers studying neuronal signaling pathways and synaptic plasticity. Furthermore, this antibody has shown antioxidant activity and may have potential therapeutic applications in neurodegenerative diseases.</p>

<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FOXR1 antibody was raised in rabbit using the N terminal of FOXR1 as the immunogen</p>

<p>Purified Polyclonal RASSF8 antibody</p>

<p>NPFF1 antibody was raised in rabbit using N terminal sequence MEGEPSQPPNSSWPLS and C terminal sequence CSHLPLTIPAWDI of the human NPFF1 protein as the immunogen.</p>

<p>RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ</p>

<p>CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its potency has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR</p>

<p>Rabbit polyclonal GLUR2 antibody (Ser880)</p>

<p>Rabbit polyclonal MDR1 antibody (HRP)</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>ERBB3 antibody was raised in Mouse using a purified recombinant fragment of ERBB3(aa1175-1275) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal Tetraspanin 8 antibody</p>

<p>Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI</p>

<p>Purified Rabbit polyclonal OR7C2 antibody</p>