Anticuerpos primarios

<p>GFI1 antibody was raised in Rabbit using Human GFI1 as the immunogen</p>

<p>Rabbit polyclonal DYN1 antibody (Ser778)</p>

<p>The p53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the p53 protein, which is a key regulator of cell growth and division. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>Affinity purified Rabbit polyclonal alpha Tubulin 1A antibody</p>

<p>HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK</p>

<p>TOR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID</p>

<p>Affinity purified Rabbit polyclonal Tuftelin 1 antibody</p>

<p>Rabbit polyclonal SPR antibody (HRP)</p>

<p>DLX3 antibody was raised in Rabbit using Human DLX3 as the immunogen</p>

<p>The AVPR1B antibody is a highly effective monoclonal antibody that targets the AVPR1B receptor. This receptor plays a crucial role in various biological processes, including the regulation of stress response and social behavior. By specifically binding to the AVPR1B receptor, this antibody inhibits its activity and modulates the downstream signaling pathways.</p>

<p>Rabbit polyclonal GRIN2B antibody (Tyr1252)</p>

<p>AHCY antibody was raised in Rabbit using Human AHCY as the immunogen</p>

<p>Phospho MBP antibody was raised in mouse using a sythetic peptide corresponding to the human myelin basic protein sequence phosphorylated at Thr98 and coupled to tuberculin as the immunogen.</p>

<p>The NOSIP antibody is a highly specialized antibody that targets endothelial growth factors. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the Life Sciences field. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rabbit polyclonal SMRC2 antibody</p>

<p>DDX21 antibody was raised in Rabbit using Human DDX21 as the immunogen</p>

<p>The ATF4 antibody is a highly specific polyclonal antibody that is used in various life science applications. It specifically targets the activating transcription factor 4 (ATF4), which plays a crucial role in cellular processes such as growth, differentiation, and stress response.</p>

<p>The PDCD2 antibody is a highly specialized monoclonal antibody that targets a specific molecule in human hepatocytes. It is designed to recognize and bind to the carboxyl terminal of the target molecule, allowing for precise detection and analysis. This antibody is derived from a hybridoma cell line, resulting in a chimeric protein that combines the specificity of human antibodies with the stability of bovine γ-globulin. The PDCD2 antibody has been extensively tested in various Life Sciences applications, including hybridization studies and immunohistochemistry. Its unique properties make it an invaluable tool for researchers studying natriuretic factors, chemokines, and other important signaling molecules. Trust the PDCD2 antibody to provide accurate and reliable results in your experiments.</p>

<p>Rabbit polyclonal PLD1 antibody</p>

<p>SPO11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC</p>

<p>KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW</p>

<p>Purified Rabbit polyclonal PR1a antibody</p>

<p>The VMAT2 antibody is a highly specialized antibody that targets the vesicular monoamine transporter 2 (VMAT2). This transporter is responsible for packaging and transporting neurotransmitters such as dopamine, serotonin, and norepinephrine into synaptic vesicles. By targeting VMAT2, this antibody can modulate the release of these neurotransmitters, making it a valuable tool in neuroscience research.</p>

<p>Affinity purified Rabbit polyclonal BIVM antibody</p>

<p>CD28 antibody was raised in rabbit using residues 72-85 [SQQLQVYSKTGFN] of the Ig-V region of human CD28 as the immunogen.</p>

<p>The PEG10 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor GM-CSF (colony-stimulating factor). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications. It has been found to inhibit the activity of phosphatase, which plays a crucial role in cell growth and differentiation. Additionally, the PEG10 antibody has been shown to have an impact on adipocyte function, making it a promising candidate for research in obesity and metabolic disorders. With its high specificity and affinity for its target, this antibody is a valuable tool for scientists working in various areas of biomedical research.</p>

<p>Purified Polyclonal TAF6L antibody</p>

<p>Rabbit polyclonal FOP antibody</p>

<p>MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH</p>

The PLAT antibody is a monoclonal antibody that specifically targets fibrinogen. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody has shown excellent binding affinity and specificity for fibrinogen, making it an ideal tool for various experimental techniques.

<p>Affinity purified Rabbit polyclonal DUSP26 antibody</p>

<p>Vitronectin antibody was raised in sheep using human Vitronectin purified from plasma as the immunogen.</p>

<p>RIT1 antibody was raised in rabbit using the middle region of RIT1 as the immunogen</p>

<p>INPP5K antibody was raised in rabbit using the C terminal of INPP5K as the immunogen</p>

<p>CD25 antibody is a monoclonal antibody that specifically targets CD25, a glycoprotein expressed on the surface of activated T cells. It is commonly used in research and clinical settings to study and treat conditions related to T cell activation, such as autoimmune diseases and certain types of cancer.</p>

<p>The Keratin 15 antibody is a glycopeptide that targets the human serum androgen. It is an essential tool for researchers in the field of Life Sciences, as it plays a crucial role in various cellular processes. This antibody specifically recognizes Keratin 15, which is a protein involved in the maintenance and integrity of epithelial tissues.</p>

<p>PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS</p>

<p>Rabbit polyclonal Canine Serum Albumin antibody (biotin)</p>

<p>Rabbit polyclonal AP2S1 antibody (biotin)</p>

<p>GALNT14 antibody was raised in Rabbit using Human GALNT14 as the immunogen</p>

<p>CRYAB antibody was raised in Rabbit using Human CRYAB as the immunogen</p>

<p>The NFIL3 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to the NFIL3 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in experiments involving acetylation, methyl transferase activity, and the activation of antinociceptive pathways.</p>

<p>Insulin-Like Growth Factor Monoclonal Antibody</p>

<p>CD84 antibody was raised in Rabbit using Human CD84 as the immunogen</p>

<p>The DCTN1 antibody is a highly specialized monoclonal antibody that targets the DCTN1 protein. This protein plays a crucial role in various cellular processes, including intracellular transport and organization of microtubules. By specifically binding to the DCTN1 protein, this antibody can modulate its function and activity.</p>

<p>The NQO1 antibody is a highly specialized monoclonal antibody that has been developed for immunoassays. It is designed to specifically target and neutralize the NQO1 protein, which plays a crucial role in cellular processes such as collagen synthesis, growth factor signaling, and tyrosine kinase receptor activation. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting NQO1 in various biological samples.</p>

<p>Affinity purified Rabbit polyclonal ASNA1 antibody</p>

<p>CYP4B1 antibody was raised in Rabbit using Human CYP4B1 as the immunogen</p>

<p>Mouse monoclonal Cytokeratin antibody cocktail (Prediluted for IHC)</p>

<p>The Podoplanin antibody is a mouse monoclonal antibody that specifically targets the antigen binding domain of Podoplanin. This antibody is designed to recognize and bind to Podoplanin, a human protein that serves as a potential biomarker in various biological processes. The antibody has been extensively tested and validated for its specificity and sensitivity in detecting Podoplanin in different samples.</p>

<p>Streptococcus group A antibody (FITC) was raised in rabbit using group A Streptococci as the immunogen.</p>

<p>Rabbit polyclonal PGF antibody</p>

<p>The LIMK1 antibody is a highly specialized phosphatase that plays a crucial role in various cellular processes. It binds to specific proteins and regulates their activity, making it an essential component for normal cell function. This antibody has been found to have antiangiogenic properties, meaning it inhibits the formation of new blood vessels. Additionally, it interacts with natriuretic peptides, which are hormones involved in regulating blood pressure and fluid balance. The LIMK1 antibody is commonly used in Life Sciences research to study the effects of growth factors such as epidermal growth factor and endothelial growth factor. Its unique binding properties make it a valuable tool for understanding complex signaling pathways and molecular interactions within cells.</p>

<p>APEH antibody was raised in Rabbit using Human APEH as the immunogen</p>

<p>DISP1 antibody was raised in Rabbit using Human DISP1 as the immunogen</p>

<p>Rabbit polyclonal ADRA2B antibody</p>

<p>Rabbit polyclonal PTPN22 antibody</p>

<p>Rabbit polyclonal AMBP antibody (biotin)</p>

<p>SARS M antibody was raised in Mouse using a purified recombinant fragment of SARS-m protein expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PSMD2 antibody</p>

<p>CCND1 antibody was raised in rabbit using the middle region of CCND1 as the immunogen</p>

<p>ARHGAP25 antibody was raised in Rabbit using Human ARHGAP25 as the immunogen</p>

<p>Rabbit Polyclonal p70 S6 Kinase antibody (Thr421)</p>

<p>AK3 antibody was raised in Rabbit using Human AK3 as the immunogen</p>

<p>DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD</p>

<p>FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE</p>

<p>MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR</p>

<p>Rabbit polyclonal CDC25C antibody (Ser198)</p>

<p>Rabbit polyclonal TPH1 antibody (Ser260)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit Polyclonal JunB antibody (Ser259)</p>

<p>MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR</p>

<p>Affinity purified Rabbit polyclonal Adenylate kinase 3 antibody</p>

The OSR1 antibody is a powerful tool in the field of life sciences. It is an interferon and glucagon-neutralizing antibody that has been extensively used in various research studies. This polyclonal antibody specifically targets OSR1 (oxidative stress-responsive 1) protein, which plays a crucial role in cellular processes related to growth, development, and homeostasis.

<p>Granzyme A antibody is a monoclonal antibody that specifically targets and binds to granzyme A, a serine protease enzyme involved in immune response and cell death. This antibody can be used for various applications in the field of Life Sciences, including research on immune system function, cancer therapy, and autoimmune diseases. It has been shown to inhibit the activity of granzyme A by blocking its binding to target cells. Additionally, this antibody has been used in experiments to study the effects of granzyme A on dopamine release, hormone peptide processing, and liver microsome metabolism. With its high specificity and affinity for granzyme A, this monoclonal antibody is a valuable tool for researchers studying immune regulation and cell signaling pathways.</p>

<p>NEK11 antibody was raised in Rabbit using Human NEK11 as the immunogen</p>

<p>FGFR4 antibody was raised in Mouse using a purified recombinant fragment of FGFR4 expressed in E. coli as the immunogen.</p>

<p>The Calmodulin antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets calmodulin, a protein that plays a crucial role in various cellular processes such as growth factor signaling, regulation of enzymes like pancreatic elastase, and calcium-dependent processes in human hepatocytes. This antibody has been extensively used in research to study the function and localization of calmodulin in different cell types and tissues.</p>

<p>IKBKB antibody was raised in Mouse using a purified recombinant fragment of IKBKB expressed in E. coli as the immunogen.</p>

<p>TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY</p>

<p>PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH</p>

<p>HNRPF antibody was raised using the C terminal of HNRPF corresponding to a region with amino acids LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNS</p>

<p>The EpoR antibody is a life sciences product that specifically targets the erythropoietin receptor (EpoR). It is a polyclonal antibody that can be used in various applications, including research and diagnostics. The EpoR antibody binds to the EpoR protein, which is a nuclear receptor involved in erythropoiesis. By targeting this receptor, the antibody can modulate the signaling pathway and affect important biological processes such as red blood cell production.</p>

<p>F4/80 Antibody (HRP)</p>

<p>CPSF2 antibody was raised in Rabbit using Human CPSF2 as the immunogen</p>

<p>The HBP1 antibody is a polyclonal antibody that targets hepatocyte growth factor. It is used in research and diagnostic applications to detect and quantify the expression levels of HBP1. This antibody specifically binds to HBP1 and can be used for various immunoassays, including Western blotting, immunohistochemistry, and ELISA. The HBP1 antibody has been shown to have high specificity and sensitivity in detecting HBP1 in various samples. It is a valuable tool for studying the role of HBP1 in different biological processes, such as cell growth, differentiation, and development. The HBP1 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. With its reliable performance and versatility, the HBP1 antibody is an essential tool for scientists working in the field of cellular biology and molecular medicine.</p>

<p>FABP4 antibody was raised in Mouse using a purified recombinant fragment of FABP4(aa61-121) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal Tensin 1 antibody</p>

<p>Rabbit Polyclonal 4EBP1 antibody (Thr45)</p>

<p>GABRA1 antibody was raised in Rabbit using Human GABRA1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal KLK11 antibody</p>

<p>Affinity purified Rabbit polyclonal NSUN6 antibody</p>

<p>Rabbit polyclonal PLANH1 antibody (biotin)</p>

<p>KDR antibody was raised in rabbit using the N terminal of KDR as the immunogen</p>

<p>Macrophage scavenger receptor antibody was raised in rat using Raw 264 cell line as the immunogen.</p>

<p>IFN gamma antibody (biotin) was raised in mouse using human IFN-gamma as the immunogen.</p>

<p>Rabbit polyclonal TRIM28 antibody (HRP)</p>

<p>ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH</p>

<p>CIB1 antibody was raised in Rabbit using Human CIB1 as the immunogen</p>