Anticuerpos primarios

<p>RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV</p>

<p>ALDH5A1 antibody was raised in rabbit using the middle region of ALDH5A1 as the immunogen</p>

<p>MRGPRX2 antibody was raised in rabbit using the middle region of MRGPRX2 as the immunogen</p>

<p>STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS</p>

<p>Neurensin 2 antibody was raised using the middle region of NRSN2 corresponding to a region with amino acids LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT</p>

<p>ZIM3 antibody was raised in rabbit using the middle region of ZIM3 as the immunogen</p>

<p>Tetraspanin 8 antibody was raised using the middle region of TSPAN8 corresponding to a region with amino acids VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG</p>

<p>GFRA2 antibody was raised using the C terminal of GFRA2 corresponding to a region with amino acids NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK</p>

<p>NXF5 antibody was raised in rabbit using the C terminal of NXF5 as the immunogen</p>

<p>SLC32A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE</p>

<p>Tenomodulin antibody was raised using the middle region of TNMD corresponding to a region with amino acids QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI</p>

<p>MAP4K2 antibody was raised using the N terminal of MAP4K2 corresponding to a region with amino acids HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE</p>

<p>ZNF670 antibody was raised in rabbit using the N terminal of ZNF670 as the immunogen</p>

<p>FGF acidic antibody was raised in rabbit using highly pure recombinant human FGF-acidic as the immunogen.</p>

<p>CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA</p>

<p>GNB4 antibody was raised in rabbit using the middle region of GNB1-4 as the immunogen</p>

<p>ZNF644 antibody was raised in rabbit using the middle region of ZNF644 as the immunogen</p>

<p>Adipolean Variant antibody was raised in rabbit using highly pure recombinant human adipolean variant as the immunogen.</p>

<p>ACSL5 antibody was raised using the C terminal of ACSL5 corresponding to a region with amino acids  ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG</p>

<p>GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC</p>

<p>MOR1 antibody was raised in rabbit using residues 386-400 NHQLENLEAETAPLP of the human, mouse and rat MOR-1 protein as the immunogen.</p>

<p>MIG antibody was raised in rabbit using highly pure recombinant human MIG as the immunogen.</p>

<p>BTF3L1 antibody was raised in rabbit using the n terminal of BTF3L1 as the immunogen</p>

<p>CCDC28A antibody was raised in rabbit using the middle region of CCDC28A as the immunogen</p>

<p>Purified Polyclonal LI Cadherin antibody</p>

<p>NCF4 antibody was raised using the middle region of NCF4 corresponding to a region with amino acids TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF</p>

<p>LRRC59 antibody was raised using the N terminal of LRRC59 corresponding to a region with amino acids TKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKL</p>

<p>UBA6 antibody was raised in rabbit using the middle region of UBA6 as the immunogen</p>

<p>IL1 beta antibody was raised in rabbit using highly pure recombinant murine IL-1-beta as the immunogen.</p>

<p>IL31 antibody was raised in rabbit using highly pure recombinant human IL-31 as the immunogen.</p>

<p>P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG</p>

<p>SCYE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQSIAGSADSKPIDVSRLDL</p>

<p>Purified Polyclonal Cadherin 8 antibody</p>

<p>ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG</p>

<p>ANKRD39 antibody was raised in rabbit using the N terminal of ANKRD39 as the immunogen</p>

<p>SLC35F1 antibody was raised using the N terminal of SLC35F1 corresponding to a region with amino acids MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQ</p>

<p>GABARAP antibody was raised in rabbit using Residues 15-31 [RSEGEKIRKKYPDRVPV] of the GABARAP protein as the immunogen.</p>

<p>MAPK7 antibody was raised in rabbit using the middle region of MAPK7 as the immunogen</p>

<p>ATG4C antibody was raised in rabbit using the middle region of ATG4C as the immunogen</p>

<p>UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogen</p>

<p>Fgf1 antibody was raised in rabbit using the N terminal of Fgf1 as the immunogen</p>

<p>COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD</p>

<p>QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA</p>

<p>ZNF641 antibody was raised in rabbit using the middle region of ZNF641 as the immunogen</p>

<p>GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTT</p>

<p>ApoA I antibody was raised against Human Apolipoprotein A1.</p>

<p>MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD</p>

<p>CRLS1 antibody was raised in rabbit using the middle region of CRLS1 as the immunogen</p>

<p>LIX antibody was raised in rabbit using highly pure recombinant murine LIX as the immunogen.</p>

<p>ZNF512 antibody was raised in rabbit using the middle region of ZNF512 as the immunogen</p>

<p>Synapsin 1 antibody is a highly specialized Polyclonal Antibody that plays a crucial role in endothelial growth and development. This antibody is widely used in the field of Life Sciences to study various cellular processes and identify specific cell antigens. The high viscosity of this antibody ensures efficient binding to target molecules, providing accurate and reliable results.</p>

<p>KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI</p>

<p>The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this</p>

<p>MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE</p>

<p>SLC10A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLG</p>

<p>ZNF608 antibody was raised in rabbit using the middle region of ZNF608 as the immunogen</p>

<p>ARR3 antibody was raised in rabbit using the middle region of ARR3 as the immunogen</p>

<p>XAGE2 antibody was raised in rabbit using the middle region of XAGE2 as the immunogen</p>

<p>TRAF3IP2 antibody was raised in rabbit using the N terminal of TRAF3IP2 as the immunogen</p>

<p>ABCD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT</p>

<p>DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD</p>

<p>ZNF580 antibody was raised in rabbit using the N terminal of ZNF580 as the immunogen</p>

<p>IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD</p>

<p>RANTES antibody was raised in rabbit using highly pure recombinant human RANTES as the immunogen.</p>

<p>Purified Polyclonal MYF6 antibody</p>

<p>ARL5A antibody was raised using the middle region of ARL5A corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA</p>

<p>USP20 antibody was raised in rabbit using the middle region of USP20 as the immunogen</p>

<p>ZIC1 antibody was raised in rabbit using the N terminal of ZIC1 as the immunogen</p>

<p>DHODH antibody was raised using the middle region of DHODH corresponding to a region with amino acids NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL</p>

<p>GNAI3 antibody was raised in rabbit using the N terminal of GNAI3 as the immunogen</p>

<p>Rabbit polyclonal Ubiquitin antibody (Prediluted for IHC)</p>

<p>Oncostatin M antibody was raised in rabbit using highly pure recombinant human oncostatin M as the immunogen.</p>

<p>LOC727817 antibody was raised in rabbit using the N terminal of LOC727817 as the immunogen</p>

<p>ADRA1D antibody was raised in rabbit using the C terminal of ADRA1D as the immunogen</p>

<p>FTH1 antibody was raised using the middle region of FTH1 corresponding to a region with amino acids NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM</p>

<p>Reck antibody was raised in rabbit using the middle region of Reck as the immunogen</p>

<p>Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAE</p>

<p>USP39 antibody was raised in rabbit using the N terminal of USP39 as the immunogen</p>

<p>BASP1 antibody was raised in rabbit using the C terminal of BASP1 as the immunogen</p>

<p>ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ</p>

<p>Sdhb antibody was raised in rabbit using the middle region of Sdhb as the immunogen</p>

<p>ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL</p>

<p>G6pc antibody was raised in rabbit using the N terminal of G6pc as the immunogen</p>

<p>Irx6 antibody was raised in rabbit using the middle region of Irx6 as the immunogen</p>

<p>RASSF8 antibody was raised in rabbit using the N terminal of RASSF8 as the immunogen</p>

<p>PTK6 antibody was raised using the middle region of PTK6 corresponding to a region with amino acids SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL</p>

<p>CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE</p>

<p>Myosin 7 antibody was raised in rabbit using the middle region of Myosin 7 as the immunogen</p>

<p>MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP</p>

<p>Purified Polyclonal IGF1 Receptor antibody</p>

<p>Purified Polyclonal ACOT2 antibody</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a vital role in cellular processes such as growth, survival, metabolism, and proliferation. As a central player in the PI3K/Akt/mTOR pathway, it integrates signals essential for cellular adaptation and function. Humans have three main Akt isoforms—Akt1, Akt2, and Akt3—each encoded by separate genes. Akt activation begins when external signals, such as growth factors or insulin, bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of PIP3 on the cell membrane, recruiting Akt and initiating two crucial phosphorylation steps at Thr308 and Ser473, after which Akt becomes fully activated and moves within the cell to phosphorylate its target proteins.Akt’s core functions include promoting cell survival by inhibiting apoptosis through phosphorylation of pro-apoptotic proteins like BAD and Caspase-9, and supporting cell growth and proliferation by activating mTOR, a key regulator of protein synthesis. It also plays a significant role in metabolic regulation, increasing glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, particularly in muscle and fat tissues. Additionally, Akt promotes angiogenesis by enhancing VEGF expression, which aids tissue repair, and supports cell migration, aiding wound healing but also facilitating cancer cell spread. Due to its extensive role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor progression, making it a target for cancer therapies. Its influence on glucose metabolism also connects Akt to insulin signaling, where pathway defects can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>IL15 antibody was raised in rabbit using E.coli-expressed murine IL-15 as the immunogen.</p>

<p>CENPB antibody was raised using the C terminal of CENPB corresponding to a region with amino acids GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK</p>

<p>The Ubiquitin antibody is a cytotoxic monoclonal antibody that has neutralizing properties against ferritin, chemokines, and interferons. It is a glycoprotein that specifically targets ubiquitin, a protein involved in various cellular processes such as protein degradation and DNA repair. This antibody can be used in Life Sciences research to study the role of ubiquitin in different biological pathways. The Ubiquitin antibody has been tested for its efficacy in inhibiting hemolysis and has shown promising results. It does not contain any excipients or liver microsomes, making it safe for use in laboratory experiments.</p>

<p>CBLL1 antibody was raised in rabbit using the N terminal of CBLL1 as the immunogen</p>

<p>Zkscan1 antibody was raised in rabbit using the C terminal of Zkscan1 as the immunogen</p>

<p>OSBPL8 antibody was raised using the middle region of OSBPL8 corresponding to a region with amino acids YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR</p>

<p>Purified Polyclonal SHARP1 antibody</p>

<p>RHOT1 antibody was raised using the middle region of RHOT1 corresponding to a region with amino acids ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR</p>