Anticuerpos primarios

<p>ACAD9 antibody was raised in Rabbit using Human ACAD9 as the immunogen</p>

<p>DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG</p>

<p>Rabbit polyclonal FOS antibody (Ser362)</p>

<p>WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP</p>

<p>CPLX1 antibody was raised in Rabbit using Human CPLX1 as the immunogen</p>

<p>CHMP1A antibody was raised in Rabbit using Human CHMP1A as the immunogen</p>

<p>RSV antibody (FITC) was raised in goat using human RSV isolate as the immunogen.</p>

<p>CDC42EP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSP</p>

<p>The Testosterone Antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of testosterone, a key steroid hormone in the human body. This antibody is designed to specifically bind to testosterone molecules, neutralizing their effects and preventing them from interacting with their target receptors.</p>

<p>Purified Polyclonal UBA7 antibody</p>

<p>The ANXA1 antibody is a highly specialized antibody that targets the adipocyte-specific antigen, Annexin A1 (ANXA1). This monoclonal antibody is widely used in Life Sciences research to study the role of ANXA1 in various biological processes. It specifically recognizes and binds to ANXA1, allowing researchers to investigate its function and regulation.</p>

<p>Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV</p>

<p>TAFI antibody was raised in sheep using human TAFI purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal PTMS antibody</p>

<p>Affinity purified Rabbit polyclonal ZNF346 antibody</p>

<p>The NOG antibody is a monoclonal antibody that specifically targets epidermal growth factor-like (EGF-like) growth factors. It belongs to the family of antibodies known as neutralizing antibodies, which are designed to inhibit the activity of specific proteins or molecules in the body. The NOG antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, demonstrating its high efficacy in combating tuberculosis. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit Polyclonal Paxillin antibody (Tyr31)</p>

<p>FABP2 antibody was raised in Rabbit using Human FABP2 as the immunogen</p>

<p>The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.</p>

<p>Affinity purified Rabbit polyclonal RASSF1 antibody</p>

<p>RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR</p>

<p>CD58 antibody was raised in Rabbit using Human CD58 as the immunogen</p>

<p>DAPK3 antibody was raised in Rabbit using Human DAPK3 as the immunogen</p>

<p>F11R antibody was raised in rabbit using the C terminal of F11R as the immunogen</p>

<p>Rabbit polyclonal FOXE3 antibody</p>

<p>HARS antibody was raised in rabbit using the N terminal of HARS as the immunogen</p>

<p>Rabbit polyclonal DDR1 antibody (Tyr513)</p>

<p>Affinity purified Rabbit polyclonal KRTHA3B antibody</p>

<p>TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV</p>

<p>Rabbit Polyclonal STAT4 antibody</p>

<p>The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Affinity purified Rabbit polyclonal GOLGA3 antibody</p>

<p>Rabbit polyclonal Smad1/5/9 antibody</p>

<p>TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF</p>

<p>GALNT4 antibody was raised in Rabbit using Human GALNT4 as the immunogen</p>

<p>ZNF778 antibody was raised in rabbit using the N terminal of ZNF778 as the immunogen</p>

<p>The AF10 antibody is a monoclonal antibody that exhibits serum albumin-binding properties. It is commonly used in the field of Life Sciences for various applications. This antibody specifically targets amyloid plaque and can be used for research related to Alzheimer's disease and other neurodegenerative disorders. In addition, the AF10 antibody has been shown to bind to nuclear proteins, antibodies, and growth factors, making it a versatile tool in various biological studies. Furthermore, this antibody has demonstrated efficacy in detecting glycosylation patterns in human serum and studying endothelial growth and necrosis factor-related apoptosis-inducing factors. With its wide range of applications, the AF10 antibody is an invaluable resource for researchers in the field of Life Sciences.</p>

<p>Purified Polyclonal MRCK alpha antibody</p>

<p>CD4 antibody was raised in Mouse using a purified recombinant fragment of human CD4 expressed in E. coli as the immunogen.</p>

<p>ERLIN2 antibody was raised in Rabbit using Human ERLIN2 as the immunogen</p>

Rabbit polyclonal GJA1 antibody (Ser368)

<p>COX7B antibody was raised in Rabbit using Human COX7B as the immunogen</p>

<p>Rabbit polyclonal DNAJ1 antibody (FITC)</p>

<p>Rabbit polyclonal HAGH antibody</p>

<p>Rabbit polyclonal Integrin beta 3 antibody (Tyr773)</p>

<p>CXCL1 antibody was raised in rabbit using the middle region of CXCL1 as the immunogen</p>

<p>XTP3TPA antibody was raised using the middle region of XTP3TPA corresponding to a region with amino acids KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug effectively inhibits bacterial growth, preventing transcription and replication. Its effectiveness has been demonstrated through extensive testing using advanced techniques such as patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations in the body, ensuring its efficacy against mycobacterium strains. With its ability to specifically bind to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibit cell growth in culture, this drug offers a promising solution for treating tuberculosis infections.</p>

<p>Rabbit polyclonal PARD3 antibody</p>

<p>Affinity purified Rabbit polyclonal LZTFL1 antibody</p>

<p>MON1A antibody was raised in rabbit using the C terminal of MON1A as the immunogen</p>

<p>GSTP1 antibody was raised in Mouse using a purified recombinant fragment of human GSTP1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal ACTB antibody (FITC)</p>

<p>Affinity purified Rabbit polyclonal TOM1L1 antibody</p>

<p>GAS8 antibody was raised using the middle region of GAS8 corresponding to a region with amino acids RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK</p>

<p>Rabbit Polyclonal GSK3 alpha antibody (Ser21)</p>

<p>EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids LAGERGTVGPSGEPGVKGEEGEKAATAEGEGVQQLREALKILAERVLILE</p>

<p>NFX1 antibody was raised in Rabbit using Human NFX1 as the immunogen</p>

<p>APOA4 antibody was raised in Rabbit using Human APOA4 as the immunogen</p>

<p>The NRP1 antibody is a reactive antigen-binding molecule that specifically targets TNF-α. It is a monoclonal antibody that has cytotoxic properties and has been extensively used in the field of Life Sciences. This antibody can bind to human serum and has shown promising results in various studies. The NRP1 antibody is highly specific and can be used for research purposes, particularly in the areas of transmembrane conductance, interleukin-6, growth factors, and human chemokines. It is available both as a monoclonal antibody and as polyclonal antibodies. With its ability to target specific molecules, the NRP1 antibody opens up new possibilities for understanding and studying various biological processes.</p>

<p>Rabbit polyclonal DYR1A antibody</p>

<p>Affinity purified Rabbit polyclonal RFC1 antibody</p>

Rabbit polyclonal PLA2G4E antibody

<p>CLEC1A antibody was raised in Rabbit using Human CLEC1A as the immunogen</p>

<p>Rabbit Polyclonal Histone H3.1 antibody (Thr3)</p>

<p>The NMDAR1 antibody is a monoclonal antibody that specifically targets the NMDA receptor subtype 1. This receptor plays a crucial role in synaptic plasticity and is involved in various physiological and pathological processes. The NMDAR1 antibody has been extensively studied in the field of neuroscience and has shown great potential for research applications.</p>

<p>CES2 antibody was raised in Rabbit using Human CES2 as the immunogen</p>

<p>The VDAC1 antibody is a highly specialized monoclonal antibody that specifically targets the plasminogen receptor, histidine. This neutralizing antibody has been extensively studied and proven to effectively inhibit the binding of plasminogen to its receptor, thereby preventing the activation of plasminogen into plasmin. By blocking this crucial step in the plasminogen activation cascade, the VDAC1 antibody has shown great potential in various therapeutic applications.</p>

<p>The Collagen 2 antibody is a highly specific monoclonal antibody that targets collagen, an essential protein found in connective tissues. This antibody is derived from human serum and has been extensively studied in the field of Life Sciences. It has shown to be effective in detecting collagen in various research applications.</p>

<p>Purified Polyclonal CARD6 antibody</p>

<p>TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED</p>

<p>ADH1A antibody was raised using a synthetic peptide corresponding to a region with amino acids NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA</p>

<p>Staphylococcus Aureus ssaA1 antigen Monoclonal Antibody</p>

<p>OR2C1 antibody was raised in rabbit using the C terminal of OR2C1 as the immunogen</p>

<p>Rabbit polyclonal RPH3A antibody</p>

<p>Affinity purified Rabbit polyclonal Cofilin 2 antibody</p>

<p>ACOX3 antibody was raised in rabbit using the C terminal of ACOX3 as the immunogen</p>

<p>Sigma 54 Monoclonal Antibody</p>

<p>Rabbit polyclonal NPEPL1 antibody</p>

<p>TMEM139 antibody was raised using the N terminal of TMEM139 corresponding to a region with amino acids ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN</p>

<p>Rabbit polyclonal PMM1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, it shows great promise in combating Mycobacterium tuberculosis strains. With its ability to specifically bind to markers expressed at high levels in these strains and inhibit cell growth in culture, this drug offers new hope in the fight against tuberculosis.</p>

<p>NSUN5C antibody was raised using the middle region of NSUN5C corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA</p>

<p>PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids  KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL</p>

<p>LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL</p>

<p>Affinity purified Mouse polyclonal APEX1 antibody</p>

<p>KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS</p>

<p>Affinity purified Rabbit polyclonal PKA alpha antibody</p>

<p>Affinity purified Rabbit polyclonal HSD3a antibody</p>

<p>CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA</p>

<p>Affinity purified Rabbit polyclonal FBXL3 antibody</p>

<p>PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH</p>

<p>AMN1 antibody was raised in Rabbit using Human AMN1 as the immunogen</p>

<p>CYCS antibody was raised in Rabbit using Human CYCS as the immunogen</p>

<p>HSD3B7 antibody was raised using the middle region of HSD3B7 corresponding to a region with amino acids QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR</p>

<p>Rabbit polyclonal AN30A antibody</p>

<p>CHML antibody was raised in rabbit using the N terminal of CHML as the immunogen</p>

<p>Purified Gram Positive Bacteria Monoclonal</p>

<p>SLC23A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK</p>