Anticuerpos primarios

<p>OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA</p>

<p>MRPS26 antibody was raised in Rabbit using Human MRPS26 as the immunogen</p>

IgG2b antibody was raised in Mouse using Rat IgG2b as the immunogen.

<p>ARMCX1 antibody was raised using the C terminal of ARMCX1 corresponding to a region with amino acids DNIKNEGLASSRKEFSRSSLFFLFKESGVCVKKIKALANHNDLVVKVKVL</p>

<p>Ankrd13d antibody was raised in rabbit using the middle region of Ankrd13d as the immunogen</p>

<p>The TBX1 antibody is a highly specialized antibody that plays a crucial role in the field of Life Sciences. It specifically targets and binds to a cell antigen found on functional endothelial cells. This antibody is produced by hybridoma cells and has been extensively studied for its ability to inhibit the growth factor responsible for the development of pluripotent stem cells.</p>

<p>RP13-102H20.1 antibody was raised using the middle region of RP13-102H20.1 corresponding to a region with amino acids EDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGA</p>

<p>PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW</p>

<p>OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS</p>

<p>GPCR5A antibody was raised using the C terminal Of Gpcr5A corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY</p>

<p>The TFCP2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the transcription factor CP2 (TFCP2) and is commonly used to study its role in various cellular processes. This antibody has been shown to effectively detect TFCP2 in different experimental settings, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Rabbit polyclonal ARPP21 antibody</p>

<p>GPD1L antibody was raised in Rabbit using Human GPD1L as the immunogen</p>

<p>Rad54 Monoclonal Antibody (HRP)</p>

<p>Rabbit polyclonal POLR2A antibody (Ser1619)</p>

<p>The GluR4 antibody is a monoclonal antibody that specifically targets the GluR4 protein, which is a subtype of glutamate receptor. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been used to detect and quantify the expression levels of GluR4 in human serum samples, as well as in different cell types.</p>

<p>Thap11 antibody was raised in rabbit using the C terminal of Thap11 as the immunogen</p>

<p>IL11RA antibody was raised in Rabbit using Human IL11RA as the immunogen</p>

<p>The Acetyl Lysine Antibody is a highly specific monoclonal antibody that recognizes acetylated lysine residues. It is widely used in the field of Life Sciences for research purposes. Acetylation is a post-translational modification that plays a crucial role in various cellular processes, including gene expression, protein function, and signal transduction.</p>

<p>The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.</p>

<p>SPOPL antibody was raised in rabbit using the middle region of SPOPL as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated using advanced techniques like the patch-clamp technique on human erythrocytes.</p>

<p>Rabbit polyclonal Tau antibody (Ser214)</p>

<p>SGK3 antibody was raised using the N terminal of SGK3 corresponding to a region with amino acids LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH</p>

<p>The MEKK2 antibody is an immunomodulatory substance that targets a specific phosphorylation site on collagen. It is designed to recognize and bind to this site, leading to the modulation of immune responses. This antibody can be used in various applications, including research studies, vaccine development, and the production of therapeutic antibodies.</p>

<p>Rat monoclonal OCT3/4 antibody</p>

<p>ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD</p>

<p>The CD44 antibody is a specific monoclonal antibody that targets the cell-extracellular matrix interaction. It is widely used in Life Sciences research for its ability to detect and analyze activated or reactive cells. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting. The CD44 antibody recognizes a surface glycoprotein called CD44, which plays a crucial role in cell adhesion, migration, and signaling. By binding to CD44, this antibody can help researchers study the function of this important biomolecule and its involvement in various cellular processes. Additionally, the CD44 antibody has been shown to have cytotoxic effects on certain types of cancer cells, making it a promising tool for targeted therapy.</p>

<p>WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA</p>

<p>The ATP6AP1 antibody is a highly specialized antibody that targets the ATP6AP1 protein. This protein is involved in various biological processes, including dopamine synthesis and secretion. The ATP6AP1 antibody has been extensively studied and found to be an effective tool for research purposes.</p>

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>

<p>The p70S6k antibody is an acidic monoclonal antibody that specifically targets the cysteine disulfide region of the p70S6k protein. It has been widely used in Life Sciences research to study the role of p70S6k in various cellular processes. This antibody has neutralizing activity against oncostatin and natriuretic factors, making it a valuable tool for investigating their signaling pathways. Additionally, the p70S6k antibody has been used as a blood biomarker for ultrasensitive detection of leukemia inhibitory factor in human serum samples. With its high affinity and specificity, this monoclonal antibody is an essential tool for researchers studying the primary amino acid sequence and structure of p70S6k using techniques such as electrode-based assays.</p>

<p>The Clock antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is specifically designed for neuroprotective purposes and is highly effective in targeting and neutralizing the Clock protein. This antibody has been extensively tested and proven to have high affinity and specificity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The Clock antibody is colloidal gold-conjugated, making it easy to detect with a simple color change reaction. It has also been shown to inhibit the activity of growth factors like endothelial growth factor and glucagon, making it a valuable tool in studying cellular signaling pathways. With its superior performance and reliability, this antibody is an essential component for any research or diagnostic project related to circadian rhythm regulation or clock genes.</p>

<p>TMF1 antibody was raised in rabbit using the N terminal of TMF1 as the immunogen</p>

<p>Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE</p>

<p>The KLKB1 antibody is a highly effective medicament used in the field of life sciences. It is widely recognized for its ability to detect and analyze colony-stimulating factors in blood plasma. This Polyclonal Antibody has shown remarkable results in various research studies, including electrochemical impedance spectroscopy and cytometry analysis. Its reactive properties make it an ideal tool for investigating messenger RNA expression and leukocyte antigen activity. Additionally, the KLKB1 antibody has demonstrated cytotoxic effects on target cells, making it a valuable asset in the study of cellular mechanisms. With its adeno-associated viral delivery system, this antibody offers a promising avenue for therapeutic applications.</p>

<p>Rabbit polyclonal RGS13 antibody</p>

<p>Purified Polyclonal CYP11B1 antibody</p>

<p>ZNF75A antibody was raised in rabbit using the N terminal of ZNF75A as the immunogen</p>

<p>ADORA3 antibody was raised in rabbit using the C terminal of ADORA3 as the immunogen</p>

<p>NPFF1 antibody was raised in rabbit using N terminal sequence MEGEPSQPPNSSWPLS and C terminal sequence CSHLPLTIPAWDI of the human NPFF1 protein as the immunogen.</p>

<p>The BMPR2 antibody is a pharmaceutical product that belongs to the class of antibodies. It specifically targets the bone morphogenetic protein receptor type 2 (BMPR2), which plays a crucial role in regulating various cellular processes, including angiogenesis and lymphangiogenesis. This antibody binds to BMPR2 and inhibits its activity, thereby modulating the signaling pathways involved in bone morphogenetic protein (BMP) signaling. By targeting BMPR2, this antibody has potential applications in the field of Life Sciences for research purposes and as a potential therapeutic agent for diseases associated with aberrant BMP signaling. With its specificity and ability to modulate BMP signaling, the BMPR2 antibody offers promising opportunities for further exploration in the field of pharmaceuticals.</p>

<p>POGK antibody was raised in rabbit using the middle region of POGK as the immunogen</p>

<p>The GAB2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including cation channel regulation and antigen-antibody reactions. This antibody specifically targets the activated form of platelet fibrinogen, which is essential for blood clotting.</p>

<p>ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA</p>

<p>RNF128 antibody was raised in rabbit using the C terminal of RNF128 as the immunogen</p>

<p>OTUB2 antibody was raised in rabbit using the middle region of OTUB2 as the immunogen</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>ZNF177 antibody was raised in rabbit using the N terminal of ZNF177 as the immunogen</p>

<p>HAND2 antibody was raised in mouse using recombinant Human Heart And Neural Crest Derivatives Expressed 2 (Hand2)</p>

<p>CENPE Monoclonal Antibody BSA/Azide Free</p>

<p>Rabbit Polyclonal Tyrosine Hydroxylase antibody (Ser40)</p>

<p>SMC1A antibody was raised in rabbit using the C terminal of SMC1A as the immunogen</p>

<p>C10ORF46 antibody was raised using the middle region of C10Orf46 corresponding to a region with amino acids SELSEYAAQDQKFQRELIQNGFTRGDQSRKRAGDELAYNSSSACASSRGY</p>

<p>Purified Polyclonal ACC alpha antibody</p>

<p>DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI</p>

<p>Apbb1 antibody was raised in rabbit using the N terminal of Apbb1 as the immunogen</p>

<p>Rabbit polyclonal P2RY4 antibody</p>

<p>The SFTPB antibody is a specific antibody used in Life Sciences research. It is a monoclonal antibody that specifically binds to surfactant protein B (SFTPB), which plays a crucial role in lung function. This antibody can be used for various applications, including the detection and quantification of SFTPB in samples such as human serum or tissue lysates. Additionally, it has been shown to have serum albumin-binding properties, making it useful for studies involving serum albumin or related proteins. The SFTPB antibody can also be used in combination with other antibodies, such as anti-thyroglobulin antibodies or phospholipid scramblase antibodies, to investigate specific pathways or protein interactions. Its high affinity and specificity make it an essential tool for researchers studying lung biology or related fields.</p>

<p>SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV</p>

<p>ARID5A antibody was raised in rabbit using the N terminal of ARID5A as the immunogen</p>

<p>Rabbit polyclonal LAMB1 antibody</p>

<p>Mouse monoclonal Hepatitis C Virus NS3 antibody</p>

<p>ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG</p>

<p>Purified Polyclonal NIP7 antibody</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr292)</p>

<p>Purified Rabbit polyclonal MGST3 antibody</p>

<p>Rabbit polyclonal DIRA1 antibody</p>

<p>The Aml1 antibody is a powerful tool in the field of immunology. It is an antibody that specifically targets and neutralizes the activity of ACTH, a hormone involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the growth and proliferation of Mycoplasma genitalium, a common pathogen responsible for several sexually transmitted infections. Additionally, the Aml1 antibody has been shown to block the activity of TGF-beta, a potent growth factor involved in tissue repair and fibrosis. Its cytotoxic properties make it an excellent candidate for targeted cancer therapy, as it can induce cell lysis in tumor cells while sparing healthy cells. Furthermore, this monoclonal antibody has demonstrated its ability to bind to collagen, providing potential applications in wound healing and tissue engineering. Overall, the Aml1 antibody is a versatile tool with numerous potential applications in research and therapeutic development.</p>

<p>The ACTA1 antibody is a powerful tool in antiestrogen therapy and Life Sciences research. This monoclonal antibody specifically targets and binds to the ACTA1 protein, which plays a crucial role in muscle contraction. By blocking the activity of ACTA1, this antibody can help researchers gain a better understanding of its function and potentially develop new treatments for various conditions.</p>

<p>PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH</p>

<p>Rabbit polyclonal LEG7 antibody</p>

<p>EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids LAGERGTVGPSGEPGVKGEEGEKAATAEGEGVQQLREALKILAERVLILE</p>

<p>RGS8 antibody was raised in rabbit using human RGS8 protein as the immunogen.</p>

<p>VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM</p>

<p>CD62L antibody (PE-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.</p>

<p>Rabbit polyclonal RAB39 antibody</p>

<p>Rabbit Polyclonal EIF2S3 antibody</p>

<p>The Furazolidone monoclonal antibody is a highly specialized and targeted therapeutic agent used in the field of Life Sciences. This monoclonal antibody specifically targets extracellular substances found in blood plasma, making it a valuable tool in various medical applications. It has shown promising results in the treatment of leukemia and other related conditions.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

<p>CXCR4 antibody was raised in rabbit using the N terminal of CXCR4 as the immunogen</p>

<p>Rabbit polyclonal RBM9 antibody</p>

<p>Rabbit polyclonal SLC12A4 antibody</p>

<p>Rabbit anti Goat IgA Secondary Antibody</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>GPD1L antibody was raised using the middle region of GPD1L corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV</p>

<p>Rabbit polyclonal ZNHIT1 antibody</p>

<p>MRPS11 antibody was raised in Rabbit using Human MRPS11 as the immunogen</p>

<p>TMCO4 antibody was raised in rabbit using the C terminal of TMCO4 as the immunogen</p>

<p>Rabbit polyclonal TRIM3 antibody</p>

<p>The XIAP antibody is a monoclonal antibody that specifically targets the X-linked inhibitor of apoptosis protein (XIAP). This protein plays a crucial role in regulating cell death and survival pathways. The XIAP antibody has been extensively studied and proven to be highly effective in neutralizing the function of XIAP, thereby promoting apoptosis in cancer cells.</p>

<p>Purified Rabbit polyclonal KIAA0513 antibody</p>

<p>Rabbit polyclonal PDGFR alpha antibody (Tyr754)</p>

<p>Rabbit Polyclonal BRCA1 antibody (Ser988)</p>

<p>ASH1L antibody was raised in mouse using recombinant Ash1 (Absent, Small, Or Homeotic)-Like (Drosophila) (Ash1L)</p>

<p>ZNF598 antibody was raised in rabbit using the middle region of ZNF598 as the immunogen</p>

<p>Purified Rabbit polyclonal ACVR2A antibody</p>

<p>Purified Polyclonal Cathepsin H antibody</p>

<p>MRM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVLGNEGSGLSQEVQASCQLLLTILPRRQLPPGLESLNVSVAAGILLHSI</p>