Anticuerpos primarios

<p>NUDT22 antibody was raised in rabbit using the C terminal of NUDT22 as the immunogen</p>

<p>SERPINB13 antibody was raised in rabbit using the middle region of SERPINB13 as the immunogen</p>

<p>Rabbit polyclonal SmG antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its effectiveness through various techniques such as patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The GFRA4 antibody is an affinity ligand that specifically targets interleukin receptors. It has been isolated from retinal tissue and can be used as a test compound in various research studies. This antibody shows potential for the development of new medicines, particularly in the field of nuclear medicine and anti-thrombotic therapies. The GFRA4 antibody is part of a group of antibodies known as polyclonal antibodies, which are widely used as inhibitors or intermediates in various biomedical applications. Additionally, it has shown promise in the detection and treatment of autoantibodies and can be utilized in adeno-associated virus-based therapies. With its versatility and specificity, the GFRA4 antibody holds great potential for advancing scientific research and medical advancements.</p>

<p>ZNF707 antibody was raised in rabbit using the N terminal of ZNF707 as the immunogen</p>

<p>KIR2DL1 antibody was raised in mouse using recombinant human kIR2DL1 (23-223 aa) purified from E. coli as the immunogen.</p>

<p>The nNOS antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.</p>

<p>SYT3 antibody was raised using the N terminal of SYT3 corresponding to a region with amino acids VSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGG</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>

<p>PUMA antibody was raised in rabbit using 17 residue sequence 29-55 [EQHLESPVPSAPGALAG] found in the exon-3-encoded region in the human PUMA-Alpha and PUMA-Beta forms of the protein as the immunogen.</p>

<p>FkBP4 antibody was raised in mouse using recombinant human FkBP4 (1-459aa) purified from E. coli as the immunogen.</p>

<p>MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ</p>

<p>CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV</p>

<p>RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV</p>

<p>Purified Polyclonal Radixin antibody</p>

<p>Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT</p>

<p>Purified Polyclonal MGCRACGAP antibody</p>

<p>ATG9A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV</p>

<p>Rabbit polyclonal RPL38 antibody (FITC)</p>

<p>SLC34A3 antibody was raised in rabbit using the middle region of SLC34A3 as the immunogen</p>

<p>The ATG5 antibody is a highly specific monoclonal antibody that binds to the ATG5 protein. It has been extensively used in various immunochemical studies and has shown great potential in the field of life sciences. The ATG5 antibody has been proven to be effective in detecting the presence of ATG5 in primary hippocampal neurons, blood plasma, and other biological samples.</p>

<p>Purified Rabbit polyclonal OR89 antibody</p>

<p>NFH antibody was raised in rabbit using repeated motif, XKSPYK domain [SPEKAKSPEKAKSC] of NFH as the immunogen.</p>

<p>EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen</p>

<p>The Frizzled 5 antibody is a highly specialized antibody that can be used in various life science research applications. It is available in both polyclonal and monoclonal forms, providing researchers with flexibility in their experiments.</p>

<p>Rabbit polyclonal RGS10 antibody</p>

<p>PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK</p>

<p>RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG</p>

<p>FABP4 antibody was raised in Rabbit using Human FABP4 as the immunogen</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG</p>

<p>ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA</p>

<p>Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS</p>

<p>GRK5 antibody was raised using the middle region of GRK5 corresponding to a region with amino acids FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG</p>

<p>SHPRH antibody was raised in rabbit using residues 515-535 (DKTKKQAVGSPRKIEKELRKS) of the mouse SHPRH protein as the immunogen.</p>

<p>TOX antibody was raised in rabbit using the N terminal of TOX as the immunogen</p>

<p>The EFNA5 antibody is a highly specialized polyclonal antibody that targets EFNA5, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and neutralizing EFNA5 in different research applications.</p>

<p>LIGHT antibody was raised in rabbit using highly pure recombinant human LIGHT as the immunogen.</p>

<p>LTK antibody was raised in rabbit using the N terminal of LTK as the immunogen</p>

<p>Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HOM-TES-103 antibody was raised in rabbit using the C terminal of HOM-TES-103 as the immunogen</p>

<p>PSA antibody was raised in mouse using human seminal fluid PSA as the immunogen.</p>

<p>HAVCR2 antibody was raised in rabbit using the C terminal of HAVCR2 as the immunogen</p>

<p>Rabbit polyclonal ATF2 antibody (Thr71or53)</p>

<p>Purified Rabbit polyclonal OR51F2 antibody</p>

<p>Purified Polyclonal B4GALT3 antibody</p>

<p>TRIM5 alpha antibody was raised in Mouse using a purified recombinant fragment of human TRIM5 alpha expressed in E. coli as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Purified Polyclonal ABHD14A antibody</p>

<p>CD56 antibody is a monoclonal antibody that specifically targets CD56, a cell surface protein found on various immune cells. This antibody can be used in immunohistochemistry and flow cytometry to detect and quantify CD56 expression. It is commonly used in research and diagnostic applications related to the study of immune cell function and diseases such as cancer. CD56 antibody works by binding to the CD56 protein, allowing for visualization and analysis of CD56-positive cells. It is highly specific and sensitive, making it a valuable tool in life sciences research.</p>

<p>The MKK3 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor and progesterone. It is commonly used in immunoassays and research studies within the field of Life Sciences. This antibody specifically binds to MKK3, a phosphatase enzyme involved in various cellular processes such as chemokine signaling and interferon response. The MKK3 antibody has been extensively validated for its specificity and sensitivity in detecting activated MKK3 in human serum samples. Additionally, it can be utilized as a valuable tool for studying the role of MKK3 in different biological pathways and for developing potential inhibitors targeting this enzyme. With its high-quality performance, this polyclonal antibody is an essential component for any researcher working in the field of Life Sciences.</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>Rabbit Polyclonal Progesterone Receptor antibody (Ser190)</p>

<p>DPYSL3 antibody was raised in Rabbit using Human DPYSL3 as the immunogen</p>

<p>Rabbit polyclonal OR2T11 antibody</p>

<p>CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.</p>

<p>Mouse monoclonal HAG2 antibody</p>

<p>C4ORF22 antibody was raised using the N terminal Of C4Orf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT</p>

<p>Rabbit Polyclonal ATP5L2 antibody</p>

<p>COG1 antibody was raised in Rabbit using Human COG1 as the immunogen</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>The XPA antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to XPA, a protein involved in DNA repair. This antibody has been widely used in studies investigating the role of XPA in various cellular processes, including DNA damage response and repair mechanisms. The XPA antibody has shown high specificity and sensitivity in detecting XPA protein levels in human serum samples. It has also been used to study the interaction between XPA and other proteins, such as taxol, atrial natriuretic peptide, and growth factors. Additionally, this antibody has been used in the development of nanocomposites for drug delivery systems and as a tool for neutralizing specific proteins in monoclonal antibody-based therapies.</p>

<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>

<p>Rabbit polyclonal CD97 alpha antibody</p>

<p>Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD</p>

<p>Rabbit polyclonal AN32C antibody</p>

<p>The POT1 antibody is a growth factor that belongs to the class of Polyclonal Antibodies. It forms dimers with calmodulin and has cytotoxic properties. This antibody is widely used in Life Sciences research, particularly in studies related to epidermal growth factor. It can be used as a monoclonal antibody or in combination with other antibodies. The POT1 antibody has neutralizing effects on human serum and has been shown to inhibit the activity of electrode and gm-csf colony-stimulating factor. Furthermore, it has been found to have potential therapeutic applications in the treatment of autoimmune diseases associated with autoantibodies.</p>

<p>FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV</p>

<p>CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV</p>

<p>ZNF75A antibody was raised in rabbit using the N terminal of ZNF75A as the immunogen</p>

<p>FGF17 antibody was raised in goat using highly pure recombinant human FGF-17 as the immunogen.</p>

<p>Purified Polyclonal PSMD6 antibody</p>

<p>Rabbit polyclonal ZNF541 antibody</p>

<p>Lipoprotein Lipase Antibody is a potent monoclonal antibody that specifically targets and neutralizes the activity of lipoprotein lipase (LPL). LPL is an enzyme that plays a crucial role in lipid metabolism, particularly in adipose tissue. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal RSU1 antibody</p>

<p>Ssr2 antibody was raised in rabbit using the C terminal of Ssr2 as the immunogen</p>

<p>Purified Polyclonal FRA2 antibody</p>

<p>Rabbit polyclonal FRS2 antibody (Tyr436)</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>The ASK1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets and neutralizes the activity of apoptosis signal-regulating kinase 1 (ASK1). ASK1 plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. By blocking the activity of ASK1, this antibody can provide valuable insights into the molecular mechanisms underlying these processes.</p>

<p>The Elk1 antibody is a biomolecule that specifically targets the Elk1 protein, making it an essential tool in life sciences research. This polyclonal antibody recognizes the glycoprotein Elk1, which plays a crucial role in various cellular processes. It is involved in gene transcription and acts as a transcription factor that regulates the expression of genes involved in cell proliferation, differentiation, and survival.</p>

<p>RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG</p>

<p>PSMC6 antibody was raised in rabbit using the C terminal of PSMC6 as the immunogen</p>

<p>Rabbit polyclonal MAP3K10 antibody</p>

<p>IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL</p>

<p>ZNF783 antibody was raised in rabbit using the middle region of ZNF783 as the immunogen</p>

<p>Rabbit Polyclonal TrkA antibody (Ser791)</p>

<p>CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW</p>

<p>Rabbit Polyclonal PKC theta antibody (Ser676)</p>

<p>The CD326 antibody is a monoclonal antibody that specifically targets the epidermal growth factor protein. It is commonly used in Life Sciences research to study the role of this protein in various cellular processes. This antibody can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA</p>

<p>C20ORF10 antibody was raised using the N terminal Of C20Orf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN</p>

<p>C21ORF62 antibody was raised using the middle region of C21Orf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL</p>

<p>Rabbit Polyclonal cJun antibody</p>

<p>FGD1 antibody was raised in rabbit using the N terminal of FGD1 as the immunogen</p>