Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.606 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.772 productos)
- Anticuerpos del metabolismo(277 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Goat anti Canine IgE
<p>Canine IgE antibody was raised in goat using canine IgE as the immunogen.</p>IL1b antibody
<p>IL1b antibody was raised in mouse using E. Coli-derived recombinant human IL1 beta/IL1F2 as the immunogen.</p>Evolocumab - solution - 5 mg/ml
CAS:<p>Inhibts PCSK9; hypercholesterolemia therapy</p>Pureza:(Reduced Ce-Sds) Min. 95%Forma y color:Clear LiquidLRRC15 antibody
<p>LRRC15 antibody was raised using the N terminal of LRRC15 corresponding to a region with amino acids LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG</p>Pureza:Min. 95%Naptumomab
CAS:<p>a human IgG1κ anti-amyloidogenic fibrillar antibody targeting serum amyloid A1 (SAA1).</p>VZV (early gene 62) antibody
<p>VZV (early gene 62) antibody was raised in ouse using Varicella Zoster Virus HZ as the immunogen.</p>Apo (a) antibody
<p>Apo (a) antibody was raised in goat using human apolipoprotein (a) as the immunogen.</p>Pureza:Min. 95%Factor VIII antibody
<p>Factor Vlll antibody was raised in mouse using purified human factor VIII as the immunogen.</p>Listeria antibody
<p>Listeria antibody was raised in goat using listeria cells from multiple strains as the immunogen.</p>Rotavirus VP6 antibody
<p>The Rotavirus VP6 antibody is a monoclonal antibody that specifically targets the VP6 protein of the rotavirus. This antibody is highly acidic and has been shown to have natriuretic properties. It has also been found to inhibit caspase-9, an enzyme involved in cell death, and can immobilize the rotavirus particles, preventing them from infecting host cells. The Rotavirus VP6 antibody is cytotoxic and has been used in immunoassays to detect rotavirus infection in human serum samples. Additionally, this antibody has shown potential as a therapeutic agent, as it can be conjugated with taxol or other cytotoxic drugs to selectively target and kill cancer cells. Its unique properties make it a valuable tool for research and diagnostic purposes in the field of virology.</p>HBsAg antibody
<p>HBsAg antibody was raised using native Hepatitis B surface antigen as the immunogen.</p>
