Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.606 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.772 productos)
- Anticuerpos del metabolismo(277 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
SIV mac251 p28 antibody
<p>SIV mac251 p28 antibody was raised in rabbit using full length recombinant p28 (SIVmac251) as the immunogen.</p>Pureza:Min. 95%HIV2 p26 antibody
<p>HIV2 p26 antibody was raised in mouse using purified, full length recombinant p26 (HIV-2 ROD) produced in E. coli expression system as the immunogen.</p>Orosomucoid antibody
<p>Orosomucoid antibody was raised in rabbit using rat alpha-1 acid glycoprotein as the immunogen.</p>Pureza:Min. 95%THC antibody
<p>THC antibody was raised in sheep using tetrahydrocannabinol-KLH as the immunogen.</p>Mouse anti Human IgG2 (Fab)
<p>Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.</p>C Peptide antibody
<p>C Peptide antibody was raised in guinea pig using synthetic human C-Peptide as the immunogen.</p>PTH antibody (Bovine)
<p>PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.</p>CD4 (T cell receptor) antibody (biotin)
<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>Goat anti Human IgE
<p>Human IgE antibody was raised in goat using human myeloma IgE as the immunogen.</p>Pureza:Min. 95%NFkB regulatory factor antibody
<p>Rabbit polyclonal NFkB regulatory factor antibody</p>Pureza:Min. 95%CD8 antibody
<p>The CD8 antibody is a highly specialized monoclonal antibody that targets the glycoprotein CD8 on the surface of cytotoxic T cells. This antibody has been widely used in various life science research applications, including immunoassays and flow cytometry.</p>PLAC1 antibody
<p>PLAC1 antibody was raised in rabbit using placenta specific antigen 1 (PLAC1) as the immunogen.</p>Pureza:Min. 95%Primidone antibody
<p>Primidone antibody was raised in goat using primidoen-KLH as the immunogen.</p>Pureza:Min. 95%Plasminogen antibody
<p>Plasminogen antibody was raised in goat using plasminogen isolated from normal human Plasma as the immunogen.</p>Streptococcus Group A antibody
<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>Pureza:Min. 95%Bombesin antibody
<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>Pureza:Min. 95%Sheep anti Rabbit IgG
<p>Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.</p>ApoA-I antibody
<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>Estrone 6 antibody
<p>Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.</p>Pureza:Min. 95%Amphetamine antibody
<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>Pureza:Min. 95%hCG beta antibody
<p>hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.</p>Pureza:Min. 95%HIV1 gp120 antibody
<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>Pureza:Min. 95%HIV1 Nef antibody
<p>HIV1 Nef antibody was raised in mouse using full length recombinant nef (HIV-1) as the immunogen.</p>CD4 antibody
<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>Pureza:Min. 95%Phenobarbital antibody
<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>Pureza:Min. 95%SIV mac251 gp120 antibody (FITC)
<p>Rabbit polyclonal SIV mac251 gp120 antibody (FITC); full SIV1 mac251 gp120 immunogen</p>NSE antibody
<p>NSE antibody was raised in mouse using NSE from the human brain as the immunogen.</p>FSH β antibody
<p>FSH Beta antibody was raised in rabbit using FSH beta-KLH as the immunogen.</p>Pureza:Min. 95%Luteinizing Hormone antibody
<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>Pureza:Min. 95%CD4 (T cell receptor) antibody (biotin)
<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>CRP antibody
<p>CRP antibody was raised in Goat using C-Reactive Protein purified from normal human Plasma/Serum as the immunogen.</p>Goat anti Human Kappa + Lambda light chain
<p>Goat anti Human kappa + lambda light chain secondary antibody</p>Glucagon antibody
<p>Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.</p>Pureza:Min. 95%Intrinsic Factor antibody
<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>TSH antibody
<p>TSH antibody was raised in mouse using TSH from the human pituitary as the immunogen.</p>HSV1 gE antibody
<p>HSV1 gE antibody was raised in mouse using herpes simplex virus I glycoprotein E (gE) as the immunogen.</p>Rabbit anti Human IgE
<p>Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.</p>Pureza:Min. 95%CRP antibody
<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>Measles Virus Nucleoprotein antibody (FITC)
<p>Goat polyclonal Measles Virus Nucleoprotein antibody (FITC)</p>HIV1 rev antibody (biotin)
<p>Mouse monoclonal HIV1 rev antibody (biotin); concentration 50 ug/vial</p>ApoB antibody
<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>Mumps virus antibody
<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>HIV1 p24 antibody (biotin)
<p>HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>Troponin T antibody
<p>Troponin T antibody was raised in mouse using human cardiac troponin T as the immunogen.</p>C-myc antibody
<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>Pureza:Min. 95%HIV1 p24 antibody
<p>HIV1 p24 antibody was raised in goat using p24 (HIV-1 IIIB) as the immunogen.</p>Pureza:Min. 95%Fluorescein Isothiocyanate (mixture of 5- and 6- isomers)
CAS:Fórmula:C21H11NO5SPureza:>97.0%(T)(HPLC)Forma y color:Light yellow to Brown powder to crystalPeso molecular:389.38o-Dianisidine Dihydrochloride [for Biochemical Research]
CAS:Fórmula:C14H16N2O2·2HClPureza:>98.0%(HPLC)Forma y color:White to Gray to Red powder to crystalPeso molecular:317.21Zika Virus Envelope Antigen Mouse Monoclonal Antibody
<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.</p> <p>Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.</p> <p>The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>Goat anti Rabbit IgG (H + L) (biotin)
<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>Pureza:Min. 95%CYP2A6 antibody
<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>Pureza:>92% By Gel Electrophoresis And Gel ScanningHPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Pureza:Min. 95%H+K+ ATPase antibody
<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>CD30 antibody (FITC)
<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>Pureza:Min. 95%CD152 antibody (PE)
<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>Pureza:Min. 95%HSPG2 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Granzyme B antibody (PE)
<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Pureza:Min. 95%Endothelin A Receptor antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Pureza:Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Pureza:Min. 95%anti-Human Procalcitonin (PCT) Antibody
<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>Pureza:Min. 95%Mouse anti-Brucella abortus antibody
<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Mouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Pureza:Min. 95%LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%BACE1 antibody
<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%Rabbit anti Goat IgG (H + L) (Alk Phos)
<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>Pureza:Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Pureza:Min. 95%Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Pureza:Min. 95%Rabbit anti Mouse IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Pureza:Min. 95%PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>VIM antibody
<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>Pureza:Min. 95%FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Pureza:Min. 95%Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>TTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Pureza:Min. 95%CEA antibody
<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>HSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>Myeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>TSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Pureza:Min. 95%TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Pureza:Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>SEK1 antibody
<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>Pureza:Min. 95%Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Pureza:Min. 95%GPR37L1 antibody
<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Pureza:Min. 95%CRP antibody
<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>


