Anticuerpos primarios

<p>Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.</p>

<p>ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>

<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>

<p>The HIV1 tat antibody is a protein that belongs to the oncostatin and natriuretic family. It acts as a kinase inhibitor and is available as both a monoclonal antibody and polyclonal antibodies in the field of Life Sciences. This antibody specifically targets the tat protein of HIV-1, which plays a crucial role in viral replication and immune evasion. By binding to the tat protein, this antibody inhibits its function and prevents viral replication.</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Humanized anti-CD19 IgG1 monoclonal antibody</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Goat anti rabbit IgG was raised in goat using highly purified rabbit IgG as the immunogen.</p>

<p>Digoxin antibody was raised in goat using digoxin-BSA as the immunogen.</p>

<p>Goat polyclonal FABP antibody</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Progesterone antibody was raised in rabbit using progesterone as the immunogen.</p>

<p>Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.</p>

<p>Anti-Human VISTA Monoclonal Antibody</p>

<p>Calcitonin antibody is a monoclonal antibody that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody has been extensively studied and shown to have high affinity for calcitonin, making it an effective tool for research and diagnostic purposes.<br><br>One of the key characteristics of this antibody is its ability to detect autoantibodies against calcitonin in human serum. These autoantibodies are associated with certain autoimmune disorders and can provide valuable insights into disease progression and treatment options.<br><br>Additionally, this antibody has been used in studies involving basic protein research. It can effectively bind to calcitonin and other related proteins, enabling researchers to study their functions and interactions.<br><br>Moreover, the calcitonin antibody has been utilized as a tool in various immunoassays. It can be conjugated with different labels such as biotin or fluorescent dyes, allowing for easy detection and quantification of calcitonin levels in biological samples.<br><br>Furthermore, this antibody has neutral</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>Goat polyclonal Human AFP antibody</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (FITC)</p>

<p>This polyclonal antibody product: affinity purified Sheep Anti-HIV-1-gp120 was produced by first immunizing sheep with a single synthetic peptide which has the amino acid sequence: APTKAKRRVVQREKR. This amino acid sequence corresponds to amino acid section 497-511 in the envelope gene gp120 protein of the BH-10 strain of HIV-1. The antibodies are then isolated from the sheep hyperimmune serum by affinity chromatography using the APTKAKRRVVQREKR sequenced synthetic peptide coupled to Sepharose. The serological activity of the antibodies is checked by ELISA and lyophilized in PBS. 0.15M NaCl (pH 7.4) without preservative.<br>The glycoprotein gp120 is an essential Human Immunodeficiency virus (HIV) envelope subunit which facilitates the entry of the HIV into CD4 T cells through binding to CD4 receptors and CCR5 or CXCR4 chemokine co-receptors on host cells. This attachment enables the second key envelope glycoprotein gp41 to form a six-helix bundle and therefore fuse to the host cell membrane. This HIV gp120 complementary antibody can be used to detect the presence of the HIV gp120 subunit in antigen detection assays such as ELISA, automated immunoassays, western blot and lateral flow.</p>

<p>Goat polyclonal Human Complement C1s antibody</p>

<p>Estradiol-3 antibody was raised in rabbit using 17 beta Estradiol-3-BSA as the immunogen.</p>

<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>

<p>HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.</p>

<p>Goat polyclonal PF4 antibody</p>

<p>Estradiol antibody was raised in goat using 17 beta estradiol-3-BSA as the immunogen.</p>

<p>Morphine 3 antibody was raised in goat using 3-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>HSV2 gD antibody was raised in mouse using herpes simplex virus 2 glycoprotein D (gD) as the immunogen.</p>

<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

<p>Rabbit polyclonal HIV2 Rev antibody</p>

<p>HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>The hCG beta antibody is a monoclonal antibody that specifically targets and neutralizes the human chorionic gonadotropin (hCG) beta subunit. This antibody is known to form dimers, which enhance its binding affinity and neutralizing activity against hCG. It has been widely used in life sciences research to study the role of hCG in various biological processes.</p>

<p>Progesterone 11 antibody was raised in rabbit using Progesterone-11-HSA as the immunogen.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>HIV1 p24 antibody (biotin) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>

<p>Rabbit polyclonal HIV1 Rev antibody (biotin)</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>TSH antibody was raised in goat using human TSH whole molecule as the immunogen.</p>

<p>FITC antibody was raised in rabbit using fluorescein isothiocyanate-KLH as the immunogen.</p>

<p>Rabbit polyclonal HIV2 p26 antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Human IgE antibody was raised in goat using human myeloma IgE as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer</p>

<p>Mouse monoclonal HIV2 gp105 antibody (HRP)</p>

<p>Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>Rabbit polyclonal Cystatin C antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>

<p>HIV1 gp120 antibody (FITC) was raised in rabbit using full length recombinant gp120 (HIV-1) expressed in baculovirus expression system as the immunogen.</p>

<p>The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola.</p>

<p>hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.</p>

<p>Goat polyclonal Plasminogen antibody</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV) produced in baculovirus as the immunogen.</p>

<p>Chymotrypsin antibody was raised in rabbit using pancreatic chymotrypsin as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>Rabbit polyclonal HIV2 gp26 antibody; immunogen full length recombinant p26 (HIV-2 ROD) produced in E.coli expression system</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>HIV1 Nef antibody was raised in mouse using full length recombinant nef (HIV-1) as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Rabbit polyclonal Ferritin antibody</p>

<p>AFP antibody was raised in rabbit using human AFP as the immunogen.</p>

<p>HIV1 Nef antibody (FITC) was raised using purified recombinant nef (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that exhibits cytotoxic properties against the Ebola virus. This antibody specifically targets and neutralizes the glycoprotein present on the surface of the virus, preventing it from infecting host cells.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>PAP antibody was raised in rabbit using affinity purified PAP as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Estriol 6 antibody was raised in rabbit using estriol-6-BSA as the immunogen.</p>

<p>Vitamin B12 antibody was raised in rabbit using Vitamin B12-BSA as the immunogen.</p>

<p>Donkey polyclonal anti Human Lambda Light Chain antibody</p>

<p>Mouse monoclonal HIV1-RT antibody (biotin)</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>