Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.606 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.776 productos)
- Anticuerpos del metabolismo(277 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
PTH antibody (Bovine)
<p>PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.</p>HIV1 p24 antibody (FITC)
<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>Folic Acid antibody
<p>Folic acid antibody was raised in rabbit using folic acid-BSA as the immunogen.</p>Androstenedione antibody
<p>Androstenedione antibody was raised in rabbit using androstenedione-19 as the immunogen.</p>Pureza:Min. 95%Ferritin antibody
<p>Ferritin antibody was raised in rabbit using human liver ferritin as the immunogen.</p>Pureza:Min. 95%Testosterone 3 antibody
<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>Pureza:Min. 95%FABP antibody
<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>Androstenedione antibody
<p>Androstenedione antibody was raised in rabbit using 4-androstene 3, 17-dione-11-protein conjugate as the immunogen.</p>Pureza:Min. 95%Treponema pallidum antibody
<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>Pureza:Min. 95%Phenobarbital antibody
<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>Pureza:Min. 95%HSV2 gD antibody
<p>HSV2 gD antibody was raised in mouse using herpes simplex virus 2 glycoprotein D (gD) as the immunogen.</p>Dilantin antibody
<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>Pureza:Min. 95%HSV1 gC antibody
<p>HSV1 gC antibody was raised in mouse using herpes simplex virus gC-1 as the immunogen.</p>HIV1 gp120 antibody
<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>Pureza:Min. 95%EPOr antibody
<p>EPOr antibody was raised in sheep using Erythropoietin (EPO) receptor as the immunogen.</p>Pureza:Min. 95%Substance P antibody
<p>Substance P antibody was raised in rabbit using substance P-BSA as the immunogen.</p>Pureza:Min. 95%Sheep anti Rabbit IgG
<p>Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.</p>PTH antibody
<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>Pureza:Min. 95%cGMP antibody
<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>Pureza:Min. 95%PTH antibody
<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>Pureza:Min. 95%ApoA-I antibody
<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>Rabbit anti Sheep IgG
<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>Pureza:Min. 95%SOD antibody
<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>Pureza:Min. 95%Testosterone 19 antibody
<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>Pureza:Min. 95%hCG antibody
<p>hCG antibody was raised in goat using highly pure immuno grade hCG as the immunogen.</p>Pureza:Min. 95%Bovine Growth Hormone antibody
<p>BGH antibody was raised in rabbit using bovine growth hormone as the immunogen.</p>Pureza:Min. 95%HIV1 p24 antibody (FITC)
<p>HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>HIV1 rev antibody (FITC)
<p>HIV1 rev antibody (FITC) was raised in rabbit using full length recombinant rev (HIV-1, HxB2, HxB3) produced in E. coli expression system as the immunogen.</p>Ebola Virus antibody
<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.</p>HIV1 p17 antibody (HRP)
<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>HIV1 gp120 antibody
<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>Pureza:Min. 95%ST2 antibody
<p>The ST2 antibody is a monoclonal antibody that has neutralizing properties against amyloid plaque. It works by binding to dopamine growth factor, which is present in human serum. This antibody is widely used in the field of life sciences for research purposes. Additionally, it has shown potential as an antiviral medicament due to its ability to inhibit the replication of certain viruses. The ST2 antibody can be used in various applications, including immunoassays and diagnostic tests. Its high specificity and affinity make it a valuable tool for studying alpha-fetoprotein and other biomarkers. With its carbon electrode technology, this monoclonal antibody offers enhanced sensitivity and accuracy in detecting target molecules.</p>HIV1 p24 antibody
<p>HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.</p>Pureza:Min. 95%Rabbit anti Human IgE
<p>Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.</p>Pureza:Min. 95%Haloperidol antibody
<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>Pureza:Min. 95%COX2 antibody
<p>COX2 antibody was raised in mouse using recombinant human COX 2 protein as the immunogen.</p>Pureza:Min. 95%Morphine 6 antibody
<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>Pureza:Min. 95%CMV p28 UL99 antibody
<p>CMV p28 UL99 antibody was raised in mouse using cytomegalovirus minor capsid protein p28 as the immunogen.</p>Goat anti Guinea Pig IgG
<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>Pureza:Min. 95%Human Growth Hormone antibody
<p>human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.</p>HIV1 p24 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>Pureza:Min. 95%HIV1 tat antibody
<p>The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.</p>HIV1 Nef antibody
<p>HIV1 Nef antibody was raised in mouse using full length recombinant nef (HIV-1) as the immunogen.</p>Amphetamine antibody
<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>Pureza:Min. 95%HIV1 gp41 antibody (FITC)
<p>Mouse monoclonal HIV1 gp41 antibody (FITC); immunogen HIV gp41; IgG1</p>CKMM antibody
<p>CKMM antibody was raised in goat using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>Pureza:Min. 95%HIV1 gp41 antibody (HRP)
<p>HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.</p>hCG β antibody
<p>The hCG beta antibody is a monoclonal antibody that specifically targets and neutralizes the human chorionic gonadotropin (hCG) beta subunit. This antibody is known to form dimers, which enhance its binding affinity and neutralizing activity against hCG. It has been widely used in life sciences research to study the role of hCG in various biological processes.</p>HIV1-RT antibody
<p>HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>Luteinizing Hormone β antibody
<p>Luteinizing hormone beta antibody was raised in goat using human LH beta as the immunogen.</p>Aldosterone 3 antibody
<p>Aldosterone-3 antibody was raised in rabbit using aldosterone-3-BSA as the immunogen.</p>Pureza:Min. 95%Goat anti Human IgE
<p>Human IgE antibody was raised in goat using human myeloma IgE as the immunogen.</p>Pureza:Min. 95%PLAC1 antibody
<p>PLAC1 antibody was raised in rabbit using placenta specific antigen 1 (PLAC1) as the immunogen.</p>Pureza:Min. 95%Estradiol 3+6 antibody
<p>Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.</p>Pureza:Min. 95%Oxyphenbutazone antibody
<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>Pureza:Min. 95%AFP antibody
<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>BNP antibody
<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>C-myc antibody
<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>Pureza:Min. 95%HIV1 rev antibody
<p>HIV1 rev antibody was raised in mouse using full length recombinant rev (HIV-1) produced in E.coli expression system as the immunogen.</p>Calcitonin antibody
<p>Calcitonin antibody is a monoclonal antibody that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody has been extensively studied and shown to have high affinity for calcitonin, making it an effective tool for research and diagnostic purposes.<br><br>One of the key characteristics of this antibody is its ability to detect autoantibodies against calcitonin in human serum. These autoantibodies are associated with certain autoimmune disorders and can provide valuable insights into disease progression and treatment options.<br><br>Additionally, this antibody has been used in studies involving basic protein research. It can effectively bind to calcitonin and other related proteins, enabling researchers to study their functions and interactions.<br><br>Moreover, the calcitonin antibody has been utilized as a tool in various immunoassays. It can be conjugated with different labels such as biotin or fluorescent dyes, allowing for easy detection and quantification of calcitonin levels in biological samples.<br><br>Furthermore, this antibody has neutral</p>HIV2 p26 antibody (HRP)
<p>Mouse monoclonal HIV2 p26 antibody (HRP)</p>Pureza:> 95% Purity As Estimated By Analysis Of Sds-Page Gel Prior To Labeling.ST2 antibody
<p>The ST2 antibody is a powerful tool in the field of Life Sciences. It specifically targets the IL-1 receptor and its binding proteins, making it an essential component in various experiments and research studies. The ST2 antibody is produced by a hybridoma cell line and has been extensively characterized for its specificity and potency.<br><br>One of the key applications of the ST2 antibody is its use as a neutralizing agent for interleukin (IL) signaling pathways. By blocking the interaction between IL-1 receptor and its ligands, the ST2 antibody effectively inhibits downstream signaling events, providing valuable insights into cellular responses mediated by IL-1.<br><br>Moreover, the ST2 antibody has been shown to have a high affinity for histone H1, a protein involved in chromatin structure and gene regulation. This interaction suggests that the ST2 antibody may play a role in modulating chromatin dynamics and epigenetic processes.<br><br>In addition to its research applications, the ST2 antibody can also be used as a</p>HIV1 p24 antibody
<p>HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>o-Dianisidine Dihydrochloride [for Biochemical Research]
CAS:Fórmula:C14H16N2O2·2HClPureza:>98.0%(HPLC)Forma y color:White to Gray to Red powder to crystalPeso molecular:317.21Fluorescein Isothiocyanate (mixture of 5- and 6- isomers)
CAS:Fórmula:C21H11NO5SPureza:>97.0%(T)(HPLC)Forma y color:Light yellow to Brown powder to crystalPeso molecular:389.38Zika Virus Envelope Antigen Mouse Monoclonal Antibody
<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.</p> <p>Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.</p> <p>The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Pureza:Min. 95%CEA antibody
<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Pureza:Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Pureza:Min. 95%CYP2A6 antibody
<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Pureza:Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Pureza:Min. 95%Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>CD152 antibody (PE)
<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>Pureza:Min. 95%HSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>H+K+ ATPase antibody
<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>TSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Pureza:Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>Pureza:>92% By Gel Electrophoresis And Gel ScanningCip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Pureza:Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Pureza:Min. 95%HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>HSPG2 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Mouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Pureza:Min. 95%Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Pureza:Min. 95%Myeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>VIM antibody
<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>Pureza:Min. 95%GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%Rabbit anti Mouse IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Pureza:Min. 95%Granzyme B antibody (PE)
<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>TTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Pureza:Min. 95%CRP antibody
<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>anti-Human Procalcitonin (PCT) Antibody
<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>Pureza:Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Pureza:Min. 95%Mouse anti-Brucella abortus antibody
<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>SEK1 antibody
<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>Pureza:Min. 95%PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>CD30 antibody (FITC)
<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>Pureza:Min. 95%


