Anticuerpos primarios

<p>RAI16 antibody was raised using the N terminal of RAI16 corresponding to a region with amino acids HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL</p>

<p>FBXL13 antibody was raised in Rabbit using Human FBXL13 as the immunogen</p>

<p>Rabbit polyclonal AFG3L2 antibody (FITC)</p>

<p>Purified Polyclonal Hydrophobestin antibody</p>

<p>Purified Rabbit polyclonal UBF antibody (Ser484)</p>

<p>Rabbit polyclonal NELFB antibody (biotin)</p>

<p>Mouse monoclonal FKBP6 antibody</p>

<p>Purified Rabbit polyclonal MEK1 antibody (Thr286)</p>

<p>Purified Polyclonal SHB antibody</p>

<p>Rabbit polyclonal RBP5 antibody</p>

<p>The TGFBR1 antibody is a highly specialized monoclonal antibody that targets the tyrosine kinase receptor TGFBR1. This antibody is widely used in various life sciences assays to study the role of TGFBR1 in different cellular processes. It has been shown to be effective in detecting and quantifying TGFBR1 in nuclear extracts, making it an essential tool for researchers studying nuclear signaling pathways.</p>

<p>Rabbit polyclonal eEF2K antibody</p>

<p>Mouse monoclonal CD235a antibody (FITC)</p>

<p>Rabbit polyclonal Tumor necrosis factor antibody (HRP)</p>

<p>DDX55 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK</p>

<p>DNASE1L3 antibody was raised in rabbit using the C terminal of DNASE1L3 as the immunogen</p>

<p>Rabbit polyclonal RTN2 antibody</p>

<p>Affinity purified Rabbit polyclonal RFC4 antibody</p>

<p>GLTP antibody was raised in Rabbit using Human GLTP as the immunogen</p>

<p>Rabbit polyclonal TLK1 antibody</p>

<p>Purified Rabbit polyclonal CSFR antibody (Tyr708)</p>

<p>The C-myc antibody is a monoclonal antibody that specifically targets the C-myc protein, a transcription factor involved in cell growth and proliferation. This antibody is widely used in life sciences research to study the expression and function of C-myc in various biological processes.</p>

<p>CSRP2 antibody was raised in Rabbit using Human CSRP2 as the immunogen</p>

<p>Purified Rabbit polyclonal MOT4 antibody</p>

<p>CD20 antibody was raised in mouse using human CD20 as the immunogen.</p>

<p>The TYRO3 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets the TYRO3 protein, which is a member of the TAM family of receptor tyrosine kinases. This antibody has been widely used in research to study the role of TYRO3 in various biological processes.</p>

<p>The Pancreatic Polypeptide antibody is a highly specialized monoclonal antibody that is designed to target and neutralize pancreatic polypeptide, a glycoprotein hormone secreted by the pancreas. This antibody has been extensively researched and proven to have cytotoxic effects on cells that express high levels of pancreatic polypeptide, making it a valuable tool in life sciences research.</p>

<p>Rabbit polyclonal Met antibody (Tyr1234)</p>

<p>HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG</p>

<p>Mouse monoclonal Stomatin antibody</p>

<p>The Tau antibody is a highly specialized product in the field of Life Sciences. It is an anti-CD33 antibody that belongs to the class of antigen binding molecules known as antibodies. This antibody specifically targets and binds to the CD33 protein, which is expressed on the surface of certain cells in the body.</p>

<p>Rat monoclonal IgA antibody (PE)</p>

<p>Affinity purified Rabbit polyclonal Hsp105 antibody</p>

<p>Rabbit polyclonal PLAGL2 antibody</p>

<p>GCHFR antibody was raised in Rabbit using Human GCHFR as the immunogen</p>

<p>Survivin antibody was raised in Mouse using a purified recombinant fragment of Survivin expressed in E. coli as the immunogen.</p>

<p>WBP2NL antibody was raised using the middle region of WBP2NL corresponding to a region with amino acids GYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLP</p>

<p>Purified Polyclonal TIF1 alpha antibody</p>

<p>Mouse monoclonal UbK63 antibody</p>

<p>The Bcr antibody is a highly specialized Polyclonal Antibody that targets the growth factor VEGF (vascular endothelial growth factor). It is designed to specifically bind to the activated form of this antigen, inhibiting its function and preventing angiogenesis. This antibody has been extensively studied and proven to have potent anti-VEGF activity, making it an ideal therapeutic option for conditions such as cancer and age-related macular degeneration.</p>

<p>B4GALT3 antibody was raised in Rabbit using Human B4GALT3 as the immunogen</p>

<p>FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE</p>

<p>The ID3 antibody is an activated antiviral protein kinase that plays a crucial role in various biological processes. It has been extensively studied using mass spectrometric methods and has shown to have 3-kinase activity. The ID3 antibody has been found to regulate the expression of c-myc, a proto-oncogene involved in cell proliferation and apoptosis. In Life Sciences, this antibody is widely used for its neutralizing properties against specific targets. Monoclonal antibodies like the ID3 antibody are highly specific and can be used for various applications, including immunoprecipitation, Western blotting, and immunohistochemistry. They have also been used in mass spectrometric analyses of human serum proteins, such as fibrinogen and interferon. With its high affinity and specificity, the ID3 antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>The NNMT antibody is a monoclonal antibody that targets and neutralizes the epidermal growth factor-like growth factor. This antibody has been shown to effectively inhibit the activity of this growth factor, which plays a crucial role in various cellular processes. The NNMT antibody can be used in research settings to study the function and regulation of this growth factor, as well as its potential therapeutic applications. Additionally, this antibody can be used in diagnostic assays to detect and quantify the levels of this growth factor in human serum or other biological samples. With its high specificity and potency, the NNMT antibody is a valuable tool for researchers and clinicians alike.</p>

<p>BAD antibody was raised in Rabbit using Human BAD as the immunogen</p>

<p>RBMS1 antibody was raised using the middle region of RBMS1 corresponding to a region with amino acids GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT</p>

<p>Rabbit polyclonal RECK antibody</p>

<p>Purified Rabbit polyclonal MYBPC1 antibody</p>

<p>EML2 antibody was raised in Rabbit using Human EML2 as the immunogen</p>

<p>Rabbit polyclonal VATPase G1 antibody (biotin)</p>

<p>The LGR4 antibody is a highly sensitive detection tool that utilizes electrochemical impedance spectroscopy to detect the presence of specific antibodies. It is designed to provide accurate and reliable results in various life science applications. The electrode used in conjunction with this antibody allows for ultrasensitive detection, making it ideal for research and diagnostic purposes.</p>

<p>Purified Polyclonal CUX1 antibody</p>

<p>Mouse monoclonal STAT4 antibody</p>

<p>LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV</p>

<p>Non-Filamentous Actin antibody was raised in mouse using chemically cross-linked actin dimmer as the immunogen.</p>

<p>The SMARCB1 antibody is a highly specialized test substance used for immunohistochemical detection. It is a monoclonal antibody that specifically targets SMARCB1, an inhibitory factor involved in the regulation of pluripotent cells. This antibody has been extensively studied and proven to be effective in detecting SMARCB1 expression in various tissues and cell types.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:<br>Enhance your tuberculosis treatment with 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, an antituberculosis drug from the rifamycins class. This powerful compound exhibits bactericidal activity against tuberculosis infection, making it an essential addition to your medication regimen. By binding to DNA-dependent RNA polymerase, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques. Metabolized through various transformations, this drug specifically targets Mycobacterium tuberculosis strains, inhibiting cell growth in culture. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective and targeted treatment of tuberculosis infection.</p>

<p>Vasohibin 1 antibody was raised using the middle region of VASH1 corresponding to a region with amino acids SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA</p>

<p>Rabbit polyclonal cMet antibody (Tyr1003)</p>

<p>The Connexin 26 antibody is a highly effective biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the Connexin 26 protein, which plays a crucial role in cell communication. This antibody is widely used to study various cellular processes, including the regulation of glucagon secretion, autoantibody production, and the function of glycoproteins and steroids. Additionally, this monoclonal antibody has been proven to be effective in detecting and studying other biomolecules such as collagen, myelin-associated glycoprotein, interferon, and basic proteins. Researchers rely on the Connexin 26 antibody for its high specificity and reliability in their studies.</p>

<p>The E Cadherin antibody is a monoclonal antibody that specifically targets E-cadherin, a cell adhesion molecule involved in various cellular processes such as growth factor signaling and β-catenin regulation. This antibody is widely used in life sciences research to study the role of E-cadherin in different biological systems.</p>

<p>EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV</p>

<p>The JAK1 antibody is a powerful tool in the field of life sciences. It specifically targets and inhibits the Janus kinase 1 (JAK1) enzyme, which plays a crucial role in various cellular processes including signal transduction, immune response, and cell growth. This antibody has been extensively studied and proven to be effective in blocking the activation of JAK1, thereby modulating downstream signaling pathways.</p>

<p>Rabbit polyclonal IKK alpha antibody</p>

<p>Rabbit polyclonal SOD1 antibody (biotin)</p>

<p>ASF antibody is a highly specialized antibody that is used in various life sciences applications. It has the ability to selectively bind to specific lectins and peptide hormones, allowing for precise detection and analysis. The ASF antibody has been extensively used in crystallization studies, where it aids in the formation of protein complexes for structural determination. It is also commonly employed in immunological assays to detect the presence of ASF in blood plasma and human serum samples. Additionally, this antibody has shown neutralizing activity against colony-stimulating factors and can be utilized in nuclear extract preparations for research purposes. Overall, the ASF antibody is a valuable tool for scientists working in diverse fields such as cell biology, immunology, and biochemistry.</p>

<p>Mouse monoclonal CD49e antibody (biotin)</p>

<p>Mouse monoclonal Placental Protein 14 antibody</p>

<p>Rabbit polyclonal PHGDH antibody (biotin)</p>

<p>The Beta actin antibody is a highly versatile and essential tool in Life Sciences research. This monoclonal antibody specifically targets fibrinogen, an activated protein involved in blood clotting. By binding to fibrinogen, the Beta actin antibody can effectively neutralize its activity, making it a valuable tool for studying the role of fibrinogen in various biological processes.</p>

<p>Rabbit polyclonal ATP1 alpha antibody</p>

<p>The JNK3 antibody is a polyclonal antibody that specifically targets the growth factor JNK3. This antibody is used in various assays to detect and measure the levels of JNK3 in different samples. It has been shown to be cytotoxic against certain cancer cell lines, such as MCF-7 breast cancer cells. The JNK3 antibody can also be used in research studies to investigate the role of JNK3 in various biological processes, including thrombocytopenia, epidermal growth, hyaluronic acid metabolism, cholinergic neurotransmission, and androgen signaling. Additionally, there are monoclonal antibodies available for specific targeting of JNK3. Overall, the JNK3 antibody is a valuable tool for studying the function and regulation of this important protein.</p>

<p>Rabbit polyclonal UBQLN3 antibody</p>

<p>C4d Complement Monoclonal Antibody</p>

<p>Rabbit polyclonal Amyloid beta A4 antibody (Thr743/668)</p>

<p>The ERBB2 antibody is a neutralizing monoclonal antibody that specifically targets the ERBB2 protein. This glycoprotein is known to play a crucial role in cell growth and division. By binding to the ERBB2 receptor, this antibody inhibits the activation of downstream signaling pathways, thereby preventing the proliferation of cancer cells.</p>

<p>Mouse monoclonal TNF alpha antibody (FITC)</p>

<p>Mouse monoclonal MHC Class I antibody (biotin)</p>

<p>Mouse monoclonal C20orf3 antibody</p>

<p>The Trypsin antibody is a highly specialized antibody that specifically binds to lysine-specific binding proteins. It has neutralizing properties and can inhibit the activity of these proteins. Additionally, this antibody has been shown to interact with various growth factors and cytokines, including epidermal growth factor (EGF), interferon-gamma (IFN-gamma), and chemokines.</p>

<p>Mouse monoclonal CD24 antibody (biotin)</p>

<p>NIT2 antibody was raised in Rabbit using Human NIT2 as the immunogen</p>

<p>The APOBEC3A antibody is a highly specialized antibody that has neutralizing and antiangiogenic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets histidine residues on chemokine proteins, preventing their interaction with receptors and inhibiting their biological activity. The APOBEC3A antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the most suitable option for their experiments. Additionally, this antibody has been found to have low-molecular-weight characteristics, making it easily accessible for various applications. Its ability to target specific growth factors, such as epidermal growth factor and TGF-beta, makes it a valuable tool in studying cellular processes and potential therapeutic interventions. Furthermore, studies have suggested that the APOBEC3A antibody may play a role in reducing amyloid plaque formation, which is associated with neurodegenerative diseases. With its diverse range of applications and potential benefits in research and medicine</p>

<p>Armenian Hamster monoclonal CD3 antibody (biotin)</p>

<p>Rabbit polyclonal CEBP epsilon antibody</p>

<p>Affinity purified Rabbit polyclonal HSD17B4 antibody</p>

<p>GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG</p>

<p>DYNLT1 antibody was raised in Rabbit using Human DYNLT1 as the immunogen</p>

<p>MARS antibody was raised in Rabbit using Human MARS as the immunogen</p>

<p>MAGOH antibody was raised in rabbit using the N terminal of MAGOH as the immunogen</p>

<p>GTPBP5 antibody was raised in Rabbit using Human GTPBP5 as the immunogen</p>

<p>CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM</p>

<p>Purified Polyclonal MCM4 antibody</p>

<p>Rabbit polyclonal AQP2 antibody (Ser261)</p>

<p>TMEM126B antibody was raised using the middle region of TMEM126B corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC</p>

<p>The ZAP70 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to the ZAP70 protein, which plays a crucial role in T-cell activation and signaling. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>The SMAD3 antibody is a powerful tool in the field of life sciences. It belongs to the class of cytotoxic antibodies and is highly effective in targeting and neutralizing specific proteins. This antibody specifically targets SMAD3, which is involved in various cellular processes such as cell growth, differentiation, and apoptosis.</p>

<p>Affinity purified Rabbit polyclonal MPP3 antibody</p>

<p>Purified Rabbit polyclonal OR5T3 antibody</p>

<p>CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN</p>

<p>Purified Polyclonal XCL2 antibody</p>

<p>CD44 antibody was raised in Rabbit using Human CD44 as the immunogen</p>

<p>Purified Polyclonal IFN Omega antibody</p>

<p>ALS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG</p>

<p>Human growth hormone antibody was raised in mouse using human pituitary GH as the immunogen.</p>

<p>The PCDGF antibody is a highly specialized monoclonal antibody that targets the growth factor associated with non-alcoholic steatohepatitis (NASH). This antibody has been extensively tested and proven to effectively neutralize the activity of this growth factor, preventing its detrimental effects on liver health. By binding to the growth factor, the PCDGF antibody inhibits its ability to induce inflammation and fibrosis in the liver.</p>

<p>IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK</p>

<p>Mouse monoclonal ELAVL1 antibody</p>

<p>Rabbit polyclonal PLK3 antibody</p>

<p>Rabbit polyclonal ECSA antibody</p>

<p>Mouse monoclonal KIDINS220 antibody</p>

<p>Affinity purified Rabbit polyclonal CPOX antibody</p>

<p>The ROCK1 antibody is a highly specific monoclonal antibody that targets the protein ROCK1. This protein plays a crucial role in various cellular processes, including cell growth, migration, and proliferation. By inhibiting the activity of ROCK1, this antibody can effectively block the signaling pathway associated with growth factors and histidine kinases.</p>

<p>RBPMS antibody was raised using the middle region of RBPMS corresponding to a region with amino acids PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC</p>

<p>Rabbit polyclonal SCFD1 antibody</p>

<p>The Clock antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is specifically designed for neuroprotective purposes and is highly effective in targeting and neutralizing the Clock protein. This antibody has been extensively tested and proven to have high affinity and specificity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The Clock antibody is colloidal gold-conjugated, making it easy to detect with a simple color change reaction. It has also been shown to inhibit the activity of growth factors like endothelial growth factor and glucagon, making it a valuable tool in studying cellular signaling pathways. With its superior performance and reliability, this antibody is an essential component for any research or diagnostic project related to circadian rhythm regulation or clock genes.</p>

<p>Rabbit polyclonal Wheat Gliadin antibody (biotin)</p>

<p>GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR</p>

<p>SLC35F5 antibody was raised using the C terminal of SLC35F5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI</p>

<p>Mouse monoclonal NIF3L1 antibody</p>

<p>CETP antibody was raised in Rabbit using Human CETP as the immunogen</p>

<p>Chlamydia trachomatis antibody (HRP) was raised in rabbit using L2 and other serovar groups as the immunogen.</p>

<p>SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE</p>

<p>Rabbit polyclonal CYP21A2 antibody</p>

<p>Rabbit polyclonal Annexin A5 antibody (biotin)</p>

<p>Rabbit polyclonal OR4K3 antibody</p>

<p>Rabbit polyclonal UBE2G1 antibody</p>

<p>Rabbit polyclonal FTH1 antibody (HRP)</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>Rabbit polyclonal GRM5 antibody</p>

<p>NARF antibody was raised in Rabbit using Human NARF as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated using advanced techniques like the patch-clamp technique on human erythrocytes.</p>

<p>Rabbit polyclonal MYOM1 antibody</p>

<p>The ING1 antibody is a polyclonal antibody that specifically targets the colony-stimulating factor known as acidic m-CSF. It is widely used in life sciences research for its ability to detect and measure the levels of this important protein. The ING1 antibody has been extensively tested and validated for its high specificity and sensitivity, making it a reliable tool for researchers studying the role of colony-stimulating factors in various biological processes.</p>

<p>The FGF8 antibody is a highly specific antibody used in Life Sciences research. It is designed to target and bind to FGF8, a protein involved in various cellular processes. This antibody can be used in experiments such as immunohistochemistry, Western blotting, and ELISA assays to detect the presence of FGF8.</p>

<p>Annexin A11 antibody was raised using the C terminal of ANXA11 corresponding to a region with amino acids RIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND</p>

<p>Rabbit polyclonal SESN3 antibody</p>

<p>Rabbit polyclonal eIF4E antibody for detection of the Phospho-Ser209 form of the eIF4E peptide.</p>

<p>The Peroxiredoxin 1 antibody is a highly specific monoclonal antibody that targets Peroxiredoxin 1, an important antioxidant enzyme involved in cellular defense against oxidative stress. This antibody has been extensively characterized and validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Rabbit polyclonal SF3B4 antibody</p>

<p>The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.</p>

<p>METT10D antibody was raised in Rabbit using Human METT10D as the immunogen</p>

<p>The CYP17A1 antibody is a monoclonal antibody that specifically targets the human serum. It is commonly used in research and diagnostic laboratories to detect and measure the levels of CYP17A1, a growth factor that plays a crucial role in various physiological processes. This monoclonal antibody has been extensively characterized and validated for its specificity and sensitivity.</p>

<p>Rabbit polyclonal F2RL2 antibody</p>

<p>NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL</p>

<p>Mycoplasma pneumoniae antibody is a highly specific monoclonal antibody that targets and neutralizes the protease activity of Mycoplasma pneumoniae, an antigen responsible for causing respiratory infections. This antibody has been extensively studied in Life Sciences and has shown excellent efficacy in inhibiting the growth and spread of Mycoplasma pneumoniae. Additionally, it has been found to inhibit the interaction between Mycoplasma pneumoniae and vitronectin, a protein involved in immune response regulation. Furthermore, this antibody has been shown to reduce the levels of interleukin-6, a pro-inflammatory cytokine, thereby reducing inflammation caused by Mycoplasma pneumoniae infection. With its potent inhibitory properties and ability to immobilize Mycoplasma pneumoniae, this antibody is a valuable tool in research and diagnostic applications for studying this pathogen and developing effective treatments.</p>

Affinity purified Rabbit polyclonal FBXO2 antibody

<p>Mouse monoclonal Filensin antibody</p>

<p>Purified Polyclonal SLC10A7 antibody</p>

<p>Rabbit polyclonal SERPINB12 antibody</p>

<p>DNAJC10 antibody was raised in Rabbit using Human DNAJC10 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal TOK1 alpha antibody</p>

<p>Rabbit polyclonal TADA3 antibody (HRP)</p>

<p>HJURP antibody was raised in Rabbit using Human HJURP as the immunogen</p>

<p>Purified Polyclonal CK2 beta antibody</p>

<p>Rabbit polyclonal TNFSF14 antibody (FITC)</p>

<p>Affinity purified Rabbit polyclonal SIAT4A antibody</p>

<p>Rabbit polyclonal TIMELESS antibody</p>

<p>Purified Polyclonal MPP10 antibody</p>

<p>Purified Rabbit polyclonal ATP5S antibody</p>

<p>Affinity purified Rabbit polyclonal alpha Tubulin 1A antibody</p>

<p>Mouse monoclonal MAPK9 antibody</p>

<p>The AKT1 antibody is a highly specialized antibody used in Life Sciences research. It is designed to detect and target specific acid modifications in proteins, making it an invaluable tool for studying various cellular processes. With its high specificity and sensitivity, this monoclonal antibody can be used in immunoassays to accurately measure the levels of specific proteins or protein modifications in samples such as human serum or cell lysates.</p>

<p>Purified Polyclonal TXNRD2 antibody</p>

<p>Rabbit polyclonal BTK antibody (Tyr551)</p>

<p>ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids FRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEV</p>

<p>Rabbit polyclonal TPST2 antibody</p>

<p>TRSPAP1 antibody was raised using the N terminal of TRSPAP1 corresponding to a region with amino acids PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY</p>

<p>Rabbit polyclonal RNMT antibody</p>

<p>UBASH3A antibody was raised using the middle region of UBASH3A corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA</p>

<p>Rabbit polyclonal RPS6KB2 antibody</p>

<p>Rabbit polyclonal metC antibody (HRP)</p>

<p>Armenian Hamster monoclonal NKG2D antibody (biotin)</p>

<p>Rabbit polyclonal RXFP4 antibody</p>

<p>FEN1 antibody was raised using the C terminal of FEN1 corresponding to a region with amino acids PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL</p>

<p>The CXCR4 antibody is a highly specialized monoclonal antibody that targets the CXCR4 protein. This protein plays a crucial role in cell growth, migration, and survival. The CXCR4 antibody has been shown to neutralize the effects of various growth factors and cytokines, including TNF-α and adalimumab. It also binds to transferrin receptors on endothelial cells, inhibiting their growth and preventing angiogenesis.</p>

<p>The IL1b antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to interleukin 1 beta (IL-1β), a glycosylated glycoprotein involved in inflammatory responses. This antibody is widely used in studies related to autoimmune diseases, cancer, and immune system disorders.</p>

<p>Mouse Monoclonal PSME1 antibody</p>

<p>The CD44 antibody is a highly specialized monoclonal antibody that targets the CD44 protein. CD44 is a cell surface glycoprotein that plays a crucial role in cell adhesion, migration, and signaling. This antibody specifically binds to CD44 and can be used for various applications in the field of life sciences.</p>

<p>ATXN2 antibody was raised in Rabbit using Human ATXN2 as the immunogen</p>

<p>The Alkaline Phosphatase antibody is a monoclonal antibody that targets the alkaline phosphatase enzyme. It has been widely used in the field of Life Sciences for various applications. This antibody specifically binds to alkaline phosphatase and inhibits its activity, making it a valuable tool for studying the function of this enzyme.</p>

<p>The INSR antibody is a monoclonal antibody that targets the insulin receptor (INSR). It has been widely used in the field of Life Sciences for research purposes. This antibody specifically recognizes and binds to the INSR, allowing for the detection and analysis of this important protein.</p>

<p>The p53 antibody is a highly reactive antibody that targets the p53 protein. It has been extensively studied and is widely used in various fields of life sciences research. This antibody specifically recognizes non-phosphorylated p53 and can be used for immunohistochemistry, Western blotting, and other applications.</p>

<p>Purified Polyclonal RHOF antibody</p>

<p>Rabbit polyclonal TMEM145 antibody</p>

<p>LOC642141 antibody was raised using the N terminal Of Loc642141 corresponding to a region with amino acids GIGQPSRTTLSHPPAPNAGHRAAVQNDAQPPSCRVQCRASGSRPEPRSAT</p>