Anticuerpos primarios

<p>HA antibody was raised in rabbit using amino acid residues YPYDVPDYA conjugated to KLH as the immunogen.</p>

<p>Lyrm4 antibody was raised in rabbit using the middle region of Lyrm4 as the immunogen</p>

<p>Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL</p>

<p>SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.</p>

<p>GPX2 antibody was raised in rabbit using the middle region of GPX2 as the immunogen</p>

<p>AGTPBP1 antibody was raised in rabbit using the N terminal of AGTPBP1 as the immunogen</p>

<p>ZNF486 antibody was raised in rabbit using the middle region of ZNF486 as the immunogen</p>

<p>RRBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF</p>

<p>C1ORF166 antibody was raised using the middle region of C1Orf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG</p>

<p>ZPBP2 antibody was raised in rabbit using the N terminal of ZPBP2 as the immunogen</p>

<p>TRAPPC2 antibody was raised in rabbit using the middle region of TRAPPC2 as the immunogen</p>

<p>ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA</p>

<p>Purified Polyclonal Kv9.2 antibody</p>

<p>PCGF4 antibody was raised in rabbit using the C terminal of PCGF4 as the immunogen</p>

<p>Purified Polyclonal GCKR antibody</p>

<p>ATP10D antibody was raised using the C terminal of ATP10D corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA</p>

<p>ZNF624 antibody was raised in rabbit using the N terminal of ZNF624 as the immunogen</p>

<p>ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS</p>

<p>C21ORF18 antibody was raised in rabbit using the C terminal of C21ORF18 as the immunogen</p>

<p>HAUS8 antibody was raised in rabbit using the N terminal of HAUS8 as the immunogen</p>

<p>PIP1 antibody was raised in rabbit using human PIP-1 protein as the immunogen.</p>

<p>OPN3 antibody was raised in rabbit using the C terminal of OPN3 as the immunogen</p>

<p>Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS</p>

<p>GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE</p>

<p>DCST1 antibody was raised using the C terminal of DCST1 corresponding to a region with amino acids SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG</p>

<p>Sec14l3 antibody was raised in rabbit using the C terminal of Sec14l3 as the immunogen</p>

<p>TNFRSF4 antibody was raised in rabbit using the middle region of TNFRSF4 as the immunogen</p>

<p>Purified Polyclonal HuB antibody</p>

<p>PCDHGC3 antibody was raised using the C terminal of PCDHGC3 corresponding to a region with amino acids IKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLS</p>

<p>DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT</p>

<p>CDS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF</p>

<p>SLC18A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT</p>

<p>ADORA2A antibody was raised in rabbit using the C terminal of ADORA2A as the immunogen</p>

<p>IL33 antibody was raised in rabbit using highly pure recombinant human IL-33 as the immunogen.</p>

<p>STX4 antibody was raised in rabbit using the middle region of STX4 as the immunogen</p>

<p>SPINT2 antibody was raised in rabbit using the middle region of SPINT2 as the immunogen</p>

<p>Akt, also called Protein Kinase B (PKB), is a serine/threonine-specific protein kinase crucial for regulating cellular functions such as growth, survival, metabolism, and proliferation. It serves as a central component in the PI3K/Akt/mTOR pathway, integrating signals required for cellular adaptation and function. Humans express three primary isoforms of Akt—Akt1, Akt2, and Akt3—each encoded by different genes. Activation of Akt starts when external signals, like growth factors or insulin, bind to cell surface receptors, which then activate phosphoinositide 3-kinase (PI3K). This cascade leads to the formation of PIP3 on the cell membrane, recruiting Akt to undergo two key phosphorylation events at Thr308 and Ser473. Once activated, Akt can travel within the cell to phosphorylate target proteins.The main functions of Akt include enhancing cell survival by blocking apoptosis through the inactivation of pro-apoptotic proteins such as BAD and Caspase-9, and promoting cell growth and proliferation by activating mTOR, a critical regulator of protein synthesis. Akt also plays a central role in metabolism, boosting glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, which is especially important in muscle and fat tissues. Additionally, Akt facilitates angiogenesis by upregulating VEGF, supporting tissue repair, and enhances cell migration, assisting in wound healing but also enabling the spread of cancer cells. Given its broad role in supporting cell growth and survival, Akt is frequently hyperactivated in cancers, fueling unchecked cell division and tumor development, which makes it a target in cancer treatments. Furthermore, Akt’s role in glucose metabolism connects it to insulin signaling, where pathway disruptions can lead to impaired glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids SGGPSSPPSDPPAMSPGPLDALSSPTSVQEADETTRSDISERPSVDDIES</p>

<p>BSG antibody was raised in rabbit using the N terminal of BSG as the immunogen</p>

<p>SLC10A3 antibody was raised in rabbit using the middle region of SLC10A3 as the immunogen</p>

<p>GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK</p>

<p>Rabbit IgM antibody was raised in goat using normal rabbit IgM as the immunogen.</p>

<p>UBN1 antibody was raised in rabbit using the C terminal of UBN1 as the immunogen</p>

<p>CHRNA5 antibody was raised in rabbit using the middle region of CHRNA5 as the immunogen</p>

<p>AMACR antibody was raised in rabbit using residues 33-48 [RVDRPGSRYDVSRLGR] of the 42 kDa human AMACR (P504S) protein as the immunogen.</p>

<p>RGD1563533 antibody was raised in rabbit using the middle region of RGD1563533 as the immunogen</p>

<p>PRRG3 antibody was raised using the N terminal of PRRG3 corresponding to a region with amino acids EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL</p>

<p>DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP</p>

<p>QARS antibody was raised in rabbit using the N terminal of QARS as the immunogen</p>

<p>STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL</p>

<p>ZNF101 antibody was raised in rabbit using the N terminal of ZNF101 as the immunogen</p>

<p>RAB35 antibody was raised in rabbit using the middle region of RAB35 as the immunogen</p>

<p>EGLN2 antibody was raised in rabbit using the middle region of EGLN2 as the immunogen</p>

<p>Mouse monoclonal p53 antibody (Prediluted for IHC)</p>

<p>GOLGA1 antibody was raised in rabbit using the N terminal of GOLGA1 as the immunogen</p>

<p>UBE2K antibody was raised in rabbit using the middle region of UBE2K as the immunogen</p>

<p>FEZF1 antibody was raised in rabbit using the C terminal of FEZF1 as the immunogen</p>

<p>P2RX5 antibody was raised using the N terminal of P2RX5 corresponding to a region with amino acids LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR</p>

<p>Nptx1 antibody was raised in rabbit using the middle region of Nptx1 as the immunogen</p>

<p>SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT</p>

<p>LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL</p>

<p>HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP</p>

<p>BACE antibody was raised in goat using highly pure (&gt;98%) recombinant human BAFF as the immunogen.</p>

<p>TIMELESS antibody was raised in rabbit using the N terminal of TIMELESS as the immunogen</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV</p>

<p>Please enquire for more information about Lambda Free Light Chain, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SLC39A10 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL</p>

<p>KLHL8 antibody was raised in rabbit using the middle region of KLHL8 as the immunogen</p>

<p>DERL3 antibody was raised using the middle region of DERL3 corresponding to a region with amino acids FFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL</p>

<p>The Parkin antibody is a peptide agent that belongs to the group of polyclonal antibodies. It is widely used in life sciences research for its ability to detect and quantify parkin protein levels. Parkin is an important regulator of cellular processes, including erythropoietin production, growth factor signaling, and inhibition of alpha-fetoprotein expression. This antibody has been extensively validated for its specificity and sensitivity in various assays, making it a valuable tool for researchers studying parkin-related pathways. Additionally, the Parkin antibody has been shown to have neutralizing effects on angiotensin-converting enzyme activity and collagen synthesis in cardiomyocytes. Its pegylated form further enhances its stability and efficacy in experimental settings. Choose the Parkin antibody for reliable results in your research endeavors.</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR</p>

<p>RNF186 antibody was raised using the middle region of RNF186 corresponding to a region with amino acids GQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHVAARRLA</p>

<p>NOMO1 antibody was raised using the N terminal of NOMO1 corresponding to a region with amino acids DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC</p>

<p>ZNF428 antibody was raised in rabbit using the middle region of ZNF428 as the immunogen</p>

<p>Purified Polyclonal ARFIP1 antibody</p>

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL</p>

<p>Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR</p>

<p>Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS</p>

<p>PIGT antibody was raised using the C terminal of PIGT corresponding to a region with amino acids LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP</p>

<p>MGC29891 antibody was raised in rabbit using the C terminal of MGC29891 as the immunogen</p>

<p>Fmo3 antibody was raised in rabbit using the middle region of Fmo3 as the immunogen</p>

<p>DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR</p>

<p>ST6GALNAC4 antibody was raised using the middle region of ST6GALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL</p>

<p>PC antibody was raised in rabbit using the C terminal of PC as the immunogen</p>

<p>PLD2 antibody was raised in rabbit using the N terminal of PLD2 as the immunogen</p>

<p>SMPDL3B antibody was raised using the N terminal of SMPDL3B corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF</p>

<p>Myxovirus antibody was raised using the C terminal of MX1 corresponding to a region with amino acids KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG</p>

<p>MDFIC antibody was raised in rabbit using the middle region of MDFIC as the immunogen</p>

<p>Flt3 Ligand antibody was raised using the N terminal of FLT3LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY</p>

<p>1110067D22Rik antibody was raised in rabbit using the middle region of 1110067D22Rik as the immunogen</p>

<p>ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES</p>

<p>ZNF664 antibody was raised in rabbit using the N terminal of ZNF664 as the immunogen</p>

<p>Fzr1 antibody was raised in rabbit using the N terminal of Fzr1 as the immunogen</p>

<p>CMA1 antibody was raised in rabbit using the C terminal of CMA1 as the immunogen</p>

<p>CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN</p>

<p>ETV1 antibody was raised in rabbit using the N terminal of ETV1 as the immunogen</p>

<p>FGF11 antibody was raised in rabbit using the N terminal of FGF11 as the immunogen</p>

<p>FRZB antibody was raised in rabbit using the middle region of FRZB as the immunogen</p>

<p>The BRCA2 antibody is a highly specialized monoclonal antibody that targets the BRCA2 protein. This protein plays a crucial role in DNA repair and maintenance of genomic stability. The antibody specifically recognizes and binds to the BRCA2 protein, leading to its immobilization and subsequent degradation.</p>

<p>The Matriptase antibody is an immunomodulatory agent that plays a crucial role in regulating cell growth and development. It acts as a growth factor and interferon, helping to modulate immune responses and promote tissue repair. This monoclonal antibody specifically targets matriptase, an enzyme involved in various cellular processes.</p>

<p>Purified Polyclonal ATF7 antibody</p>

<p>UGT2A3 antibody was raised using the N terminal of UGT2A3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN</p>

<p>Clec1b antibody was raised in rabbit using the N terminal of Clec1b as the immunogen</p>

<p>Sntg1 antibody was raised in rabbit using the N terminal of Sntg1 as the immunogen</p>

<p>ZNF724P antibody was raised in rabbit using the N terminal of ZNF724P as the immunogen</p>

<p>VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL</p>

<p>Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV</p>

<p>ZXDC antibody was raised in rabbit using the middle region of ZXDC as the immunogen</p>

<p>ZNF286 antibody was raised in rabbit using the N terminal of ZNF286 as the immunogen</p>

<p>TSLP antibody was raised in rabbit using highly pure recombinant human TSLP as the immunogen.</p>

<p>CYP4F12 antibody was raised using the middle region of CYP4F12 corresponding to a region with amino acids DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV</p>

<p>Vamp1 antibody was raised in rabbit using the middle region of Vamp1 as the immunogen</p>

<p>CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN</p>

<p>Purified Polyclonal ITPKC antibody</p>

<p>IL10 antibody was raised in rabbit using highly pure recombinant rat IL-10 as the immunogen.</p>

<p>Purified Polyclonal MNDA antibody</p>

<p>FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS</p>

<p>SRD5A3 antibody was raised using the N terminal of SRD5A3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN</p>

<p>DHODH antibody was raised using the C terminal of DHODH corresponding to a region with amino acids GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS</p>

<p>ACADVL antibody was raised in rabbit using the C terminal of ACADVL as the immunogen</p>

<p>KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC</p>

<p>Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS</p>

<p>PDE1A antibody was raised in rabbit using the C terminal of PDE1A as the immunogen</p>

<p>IL1 beta antibody was raised using the N terminal of IL1B corresponding to a region with amino acids MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL</p>

<p>GRK1 antibody was raised in rabbit using the middle region of GRK1 as the immunogen</p>

<p>GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI</p>

<p>CTF1 antibody was raised in rabbit using the N terminal of CTF1 as the immunogen</p>

<p>Rnf122 antibody was raised in rabbit using the middle region of Rnf122 as the immunogen</p>

<p>SLC35D3 antibody was raised using the N terminal of SLC35D3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL</p>

<p>TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA</p>

<p>COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen</p>

<p>Klhl12 antibody was raised in rabbit using the N terminal of Klhl12 as the immunogen</p>

<p>ZNHIT1 antibody was raised in rabbit using the N terminal of ZNHIT1 as the immunogen</p>

<p>KIAA1604 antibody was raised in rabbit using the C terminal of KIAA1604 as the immunogen</p>

<p>UBE2K antibody was raised in rabbit using the N terminal of UBE2K as the immunogen</p>

<p>Purified Polyclonal SRSF7 antibody</p>

<p>SOHLH2 antibody was raised in rabbit using the middle region of SOHLH2 as the immunogen</p>

<p>TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV</p>

<p>Aadacl1 antibody was raised in rabbit using the middle region of Aadacl1 as the immunogen</p>

<p>Ribophorin II antibody was raised using the N terminal of RPN2 corresponding to a region with amino acids ASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVA</p>

<p>MGLL antibody was raised in rabbit using the N terminal of MGLL as the immunogen</p>

<p>KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ</p>

<p>Purified Polyclonal MRPL39 antibody</p>

<p>SLC22A13 antibody was raised using the N terminal of SLC22A13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM</p>

<p>GLUL antibody was raised in rabbit using the C terminal of GLUL as the immunogen</p>

<p>ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen</p>

<p>The vacA antibody is a glycoprotein that plays a crucial role in various biological processes. It exhibits phosphatase and tyrosinase activity, which are essential for cellular functions. This cytotoxic antibody binds to specific proteins and antigens, enabling targeted interactions in the body. In human serum, the vacA antibody has been shown to modulate melanogenesis, the process of pigment production in the skin. Its glycopeptide structure allows for effective antigen-antibody reactions, making it an ideal tool for research and diagnostic purposes. Whether you need a monoclonal or polyclonal antibody, our high-quality vacA antibodies are produced using state-of-the-art hybridoma cell technology. Trust our expertise in Life Sciences to provide you with reliable and accurate results for your scientific endeavors.</p>

<p>Psmd10 antibody was raised in rabbit using the N terminal of Psmd10 as the immunogen</p>

<p>RNF167 antibody was raised in rabbit using the middle region of RNF167 as the immunogen</p>

<p>PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQV</p>

<p>C19ORF56 antibody was raised using the N terminal Of C19Orf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML</p>

<p>Igf2bp3 antibody was raised in rabbit using the middle region of Igf2bp3 as the immunogen</p>

<p>RGL3 antibody was raised in rabbit using the middle region of RGL3 as the immunogen</p>

<p>PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP</p>

<p>HERC5 antibody was raised using the N terminal of HERC5 corresponding to a region with amino acids CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ</p>

<p>The Cathepsin G antibody is a highly effective and versatile basic protein that plays a crucial role in the immune system. This antibody specifically targets and neutralizes the activity of Cathepsin G, an enzyme involved in various physiological processes. By inhibiting Cathepsin G, this antibody helps regulate immune responses and maintain overall health.</p>

<p>LTB antibody was raised using a synthetic peptide corresponding to a region with amino acids AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS</p>

<p>EGLN2 antibody was raised in rabbit using the N terminal of EGLN2 as the immunogen</p>

<p>NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM</p>

<p>Slc25a31 antibody was raised in rabbit using the middle region of Slc25a31 as the immunogen</p>

<p>PTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV</p>

<p>Cpne5 antibody was raised in rabbit using the N terminal of Cpne5 as the immunogen</p>

<p>CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV</p>

<p>PARVB antibody was raised using the N terminal of PARVB corresponding to a region with amino acids LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV</p>

<p>ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG</p>

<p>Hemopexin antibody was raised against Human Hemopexin.</p>

<p>EAP30 antibody was raised in rabbit using the N terminal of EAP30 as the immunogen</p>

<p>KDELR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW</p>

<p>SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL</p>

<p>PAIP2 antibody was raised in rabbit using the N terminal of PAIP2 as the immunogen</p>

<p>Cnih antibody was raised in rabbit using the N terminal of Cnih as the immunogen</p>

<p>Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK</p>

<p>DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW</p>