Anticuerpos primarios

<p>The DSG2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to a specific antigen, which plays a crucial role in cell growth and development. This antibody has been extensively tested and proven to be effective in inhibiting the activity of growth factors, thereby preventing the proliferation of certain cells.</p>

<p>MAP4K1 antibody was raised using the N terminal of MAP4K1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK</p>

<p>GIMAP2 antibody was raised in Rabbit using Human GIMAP2 as the immunogen</p>

<p>Mouse monoclonal FOSL1 antibody</p>

<p>Rabbit Polyclonal RCAN1 antibody</p>

<p>The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.</p>

<p>The BIN3 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets adipose triglyceride lipase (ATGL), a key enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications, as well as its role in understanding the mechanisms of obesity and related metabolic disorders.</p>

<p>SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE</p>

<p>ATG10 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP</p>

<p>DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML</p>

<p>Mouse monoclonal LAMB2 antibody</p>

<p>Calcitonin antibody was raised in mouse using calcitonin conjugated with carrier protein as the immunogen.</p>

<p>ITGA4 antibody was raised in Rabbit using Human ITGA4 as the immunogen</p>

<p>The Toll-like receptor 2 antibody is a powerful tool in Life Sciences research. It is a monoclonal antibody that specifically targets Toll-like receptor 2 (TLR2), an important component of the innate immune system. TLR2 plays a crucial role in recognizing and responding to microbial pathogens, making it an attractive target for therapeutic interventions.</p>

<p>CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface glycoprotein expressed on activated leukocytes. This antibody has antiangiogenic properties and can induce apoptosis in tumor cells by binding to the necrosis factor-related apoptosis-inducing ligand (TRAIL). CD11b antibody can be used in various applications, including immunoprecipitation, Western blotting, and flow cytometry. It has been shown to inhibit the adhesion of leukocytes to endothelial cells and block the migration of leukocytes into inflamed tissues. Additionally, CD11b antibody can be used for the detection of CD11b in nuclear extracts and human serum samples. Its high specificity and affinity make it a valuable tool in Life Sciences research and diagnostic applications.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. The drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>CD144 antibody is a monoclonal antibody that specifically targets CD144, also known as vascular endothelial cadherin (VE-cadherin). It plays a crucial role in maintaining the integrity and stability of endothelial cell-cell junctions. CD144 antibody can be used in various life science research applications, including the study of interleukin-6 signaling, influenza hemagglutinin binding assays, and the detection of reactive oxygen species.</p>

<p>Purified Polyclonal Alpha actin 1 antibody</p>

<p>The REDD1 antibody is a highly specialized product used in Life Sciences research. It is an immunogenic composition designed to target and detect the presence of REDD1 protein in various biological samples. The REDD1 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable tool for researchers studying the role of REDD1 in different cellular processes.</p>

<p>Rabbit polyclonal TIMM9 antibody</p>

<p>Mouse monoclonal TMED1 antibody</p>

<p>The CD160 antibody is a monoclonal antibody that targets the CD160 protein, which is involved in immune response regulation. It acts as a colony-stimulating factor and plays a role in the activation of macrophages. The CD160 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various experimental models. It has been shown to inhibit the activity of phosphatase enzymes and interfere with interferon signaling pathways. Additionally, it has been found to bind to glutamate receptors and modulate their function. The CD160 antibody is highly specific and exhibits strong binding affinity to its target. It can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. This high-quality antibody is suitable for research purposes and is compatible with human serum samples.</p>

<p>EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal Fibulin 1 antibody</p>

<p>PSMD11 antibody was raised in mouse using recombinant human PSMD11 (1-422aa) purified from E. coli as the immunogen.</p>

<p>KRR1 antibody was raised in Rabbit using Human KRR1 as the immunogen</p>

<p>The SENP1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the protein SUMO-specific protease 1 (SENP1), which plays a crucial role in the regulation of various cellular processes. This antibody has been extensively validated and is known for its high specificity and sensitivity.</p>

<p>RAP1GAP antibody was raised using the middle region of RAP1GAP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA</p>

<p>Eotaxin antibody was raised in mouse using highly pure recombinant human eotaxin as the immunogen.</p>

<p>Rabbit polyclonal DAPP1 antibody (Tyr139)</p>

<p>IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen</p>

<p>Purified Polyclonal GNL1 antibody</p>

<p>Rabbit polyclonal SLC19A3 antibody</p>

<p>Rabbit polyclonal OLFML2B antibody</p>

<p>Rabbit polyclonal PDGFRa antibody (Tyr849)</p>

<p>TNFSF12 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the TNFSF12 molecule, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody has been extensively studied and shown to effectively block the activity of TNFSF12, thereby modulating its downstream effects.</p>

<p>The Collagen Type IV antibody is a powerful tool in the field of Life Sciences. Produced by hybridoma cells, this antibody specifically targets collagen, a vital component of connective tissues. It has been shown to have inhibitory effects on helicobacter growth and can be used to detect autoantibodies in various diseases. Additionally, the Collagen Type IV antibody can be utilized as a substrate for siRNA delivery or as an anti-connexin agent. With its high specificity and affinity, this monoclonal antibody is widely used in research laboratories for studying endothelial growth and the role of collagen in various biological processes.</p>

<p>The Methcathinone Antibody is a highly specialized product used in the field of Life Sciences. This antibody is designed to specifically target and bind to methcathinone, a psychoactive stimulant. It is produced through a complex process involving the activation of ester groups and acidolysis reactions.</p>

<p>Purified Polyclonal GUCY1B3 antibody</p>

<p>Rabbit polyclonal GPR27 antibody</p>

<p>Rabbit polyclonal CBX6 antibody</p>

<p>The Elastin antibody is a neutralizing inhibitor that is widely used in Life Sciences research. It specifically targets protein kinases involved in the regulation of TGF-beta signaling pathway, P2X receptors, and collagen synthesis. This antibody has been shown to effectively block the activation of these proteins, preventing the downstream effects such as proton release, superoxide production, and chemokine secretion. Additionally, the Elastin antibody is commonly used for immunohistochemistry and immunofluorescence experiments to detect elastin expression in various tissues and cell types. It is a polyclonal antibody derived from animals and exhibits high specificity and sensitivity. Researchers often rely on this antibody to study the role of elastin in various biological processes and its potential as a therapeutic target for conditions related to mesenchymal stem cells dysfunction.</p>

<p>GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK</p>

<p>Purified Rabbit polyclonal CD32 antibody (Tyr292)</p>

<p>RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr136)</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>The P54 antibody is a highly specialized protein that belongs to the family of kinase inhibitors. It is commonly used in Life Sciences research and has shown promising results in various studies. This polyclonal antibody specifically binds to proteins involved in the regulation of cell growth, such as epidermal growth factor (EGF) and androgen receptors.</p>

<p>Rat monoclonal 41BB Ligand antibody (PE)</p>

<p>FAK antibody was raised in Mouse using a purified recombinant fragment of human FAK expressed in E. coli as the immunogen.</p>

<p>The OR1D2 antibody is a highly specialized fibroin that exhibits cytotoxic properties. This antibody specifically targets TGF-beta, a key protein involved in various cellular processes. It also interacts with fibrinogen, a crucial protein for blood clotting. The OR1D2 antibody is available as both polyclonal and monoclonal antibodies, providing flexibility for different research needs. In addition, it has been shown to inhibit caspase-9 activity, an enzyme involved in apoptosis. Researchers in the life sciences field can utilize this antibody as a valuable tool for studying signal transduction pathways and family kinase inhibitors. Its immobilization capabilities make it ideal for binding proteins on surfaces or electrodes, facilitating various experimental setups.</p>

<p>The AK3 antibody is a nephrotoxic monoclonal antibody that is used in the field of Life Sciences. It has been extensively studied for its ability to detect protein biomarkers in various biological samples, including human serum. The AK3 antibody specifically targets histidine residues and can be used as a tool for the detection and quantification of proteins that contain this amino acid. It has also been shown to have inhibitory effects on epidermal growth factor and alpha-fetoprotein, making it a valuable tool for research in cancer biology. The AK3 antibody is commonly used in immunoassays and can be utilized with techniques such as carbon electrode-based assays or colloidal gold-based assays. Its high specificity and sensitivity make it an essential component in many research laboratories.</p>

<p>Rabbit polyclonal TEX12 antibody</p>

<p>Rabbit polyclonal RHOXF2 antibody</p>

<p>Rabbit polyclonal TNKS1BP1 antibody</p>

<p>Mouse monoclonal M-Ficolin antibody</p>

<p>The CDCP1 antibody is a growth factor that plays a crucial role in various cellular processes. It is an apical membrane protein and has been found to be a potential target for anti-CD20 antibodies. The CDCP1 antibody specifically recognizes and binds to the human folate receptor, inhibiting its activity. This monoclonal antibody has been extensively studied in the field of life sciences and has shown promising results as a therapeutic agent. Its unique glycosylation pattern allows for enhanced stability and efficacy. Additionally, the CDCP1 antibody has been found to activate signaling pathways involved in hepatocyte growth, making it a valuable tool for research in this area. With its high specificity and affinity towards its target antigen, this monoclonal antibody is a powerful tool for scientists and researchers alike.</p>

<p>GRWD1 antibody was raised in Rabbit using Human GRWD1 as the immunogen</p>

<p>Purified Polyclonal Cytochrome P450 3A4/5 antibody</p>

<p>Mouse monoclonal PPME1 antibody</p>

<p>NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG</p>

<p>Rat monoclonal B7DC antibody</p>

<p>TPH2 antibody was raised using the N terminal of TPH2 corresponding to a region with amino acids REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS</p>

<p>Mouse monoclonal NTF3 antibody</p>

<p>The Dendritic Cell antibody is a monoclonal antibody that specifically targets dendritic cells. Dendritic cells play a crucial role in the immune system by presenting antigens to T cells and initiating an immune response. This antibody binds to the GM-CSF receptor on dendritic cells, promoting their maturation and activation.</p>

<p>Rabbit polyclonal LRP2 antibody</p>

<p>The ST3GAL4 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the ST3GAL4 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in applications such as immunohistochemistry, immunofluorescence, Western blotting, and flow cytometry.</p>

<p>HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR</p>

<p>Rabbit polyclonal HS71L antibody</p>

<p>METTL7B antibody was raised in Rabbit using Human METTL7B as the immunogen</p>

<p>The USP7 antibody is a monoclonal antibody that specifically binds to the receptor for colony-stimulating factor (CSF). This antibody has been shown to have cytotoxic effects on cells that express high levels of the CSF receptor, making it a promising therapeutic option in the field of life sciences. The USP7 antibody works by neutralizing the activity of CSF, which is a growth factor involved in cell proliferation and differentiation. By blocking the binding of CSF to its receptor, this antibody inhibits the downstream signaling pathways that promote cell growth and survival. Additionally, the USP7 antibody has been found to interact with calmodulin and form dimers, which further enhances its cytotoxic effects. With its ability to selectively target activated cells expressing high levels of the CSF receptor, this monoclonal antibody holds great potential for targeted therapy in various diseases.</p>

<p>The beta Actin antibody is a highly specific monoclonal antibody that targets the beta-actin protein. It is widely used in research and diagnostic applications to detect and quantify the expression levels of beta-actin in various samples, including human serum. This antibody has been proven to be cytotoxic towards cells expressing sclerostin, an antigen associated with bone disorders. The beta Actin antibody can be used in a variety of assays, including Western blotting, immunohistochemistry, and flow cytometry, to study the localization and function of beta-actin in different cellular contexts. Its high specificity and sensitivity make it an indispensable tool for researchers studying cellular processes such as cell motility, cytoskeletal dynamics, and intracellular signaling pathways involving beta-actin.</p>

<p>CD45RO Monoclonal Antibody (HRP)</p>

<p>CACYBP antibody is a serum marker used in Life Sciences to detect the presence of dopamine. It is commonly used in research involving pluripotent stem cells. This antibody specifically targets CACYBP, a protein involved in various cellular processes. The CACYBP antibody can be used for chromatographic and immunological assays to study the activation and function of CACYBP. It can also be used as a diagnostic tool to detect autoantibodies associated with certain diseases. Additionally, this antibody can be used in the development of monoclonal antibodies or other therapeutic agents targeting CACYBP. Its application extends to studies involving methyl transferase activity, interferon-stimulated gene expression, acetylcholine signaling, and transmembrane conductance.</p>

<p>Rabbit polyclonal SDP3 antibody (HRP)</p>

<p>Rabbit Polyclonal GPT antibody (biotin)</p>

<p>Rabbit polyclonal SCN2B antibody</p>

<p>The MAP2K2 antibody is a highly effective monoclonal antibody that has neutralizing properties. It acts by targeting and inhibiting the activity of MAP2K2, a protein involved in cellular signaling pathways. This antibody is particularly useful in studies involving antibodies, autoantibodies, interferon, and colony-stimulating factors. It has been extensively tested on various cell lines, including MCF-7 cells, and has shown excellent results in blocking the activity of MAP2K2. Additionally, this antibody has been found to have inhibitory effects on antiphospholipid antibodies and other factors that contribute to disease progression. With its high specificity and potency, the MAP2K2 antibody is an invaluable tool for researchers studying signal transduction pathways and developing targeted therapies.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>H2AFY antibody was raised using the middle region of H2AFY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG</p>

<p>Mouse monoclonal CHEK2 antibody</p>

<p>The p300 antibody is a highly specialized antibody that is commonly used in the field of Life Sciences. It is an acidic, polyclonal antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied and shown to have neutralizing and inhibitory effects on certain factors, making it a valuable tool for researchers.</p>

<p>TRPA1 antibody was raised using the middle region of TRPA1 corresponding to a region with amino acids KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL</p>

<p>GPT2 antibody was raised in Rabbit using Human GPT2 as the immunogen</p>

<p>Mouse monoclonal RFXANK antibody</p>

<p>The ACY1 antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of life sciences. This antibody specifically targets and neutralizes the ACY1 protein, which is involved in several important biological processes.</p>

<p>Mouse monoclonal MICAL1 antibody</p>

<p>Purified Polyclonal Heme Oxygenase 2 antibody</p>

<p>Rabbit polyclonal SHPK antibody</p>

<p>The ATF2 antibody is a polyclonal antibody that specifically targets ATF2, a transcription factor involved in various cellular processes. This antibody can be used for research purposes to study the role of ATF2 in different signaling pathways and gene regulation. It has been shown to have neutralizing activity against ATF2 and can be used to inhibit its function in vitro and in vivo. The ATF2 antibody is highly specific and does not cross-react with other proteins, making it a reliable tool for studying ATF2-mediated processes. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The antibody is formulated with excipients to ensure stability and maintain its functionality over time.</p>

<p>Purified Rabbit polyclonal LEPREL1 antibody</p>

<p>KLK11 antibody was raised in Rabbit using Human KLK11 as the immunogen</p>

<p>Rabbit polyclonal BLOC1S1 antibody</p>

<p>The GluR4 antibody is a monoclonal antibody that specifically targets the GluR4 protein, which is a subtype of glutamate receptor. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been used to detect and quantify the expression levels of GluR4 in human serum samples, as well as in different cell types.</p>

<p>RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Rabbit polyclonal CrkL antibody (Tyr207)</p>

<p>RBM42 antibody was raised using the middle region of RBM42 corresponding to a region with amino acids RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS</p>

<p>The SOCS3 antibody is a neuroprotective monoclonal antibody that has acidic properties. It is designed to target and bind to fibronectin, insulin, collagen, and other glycosylation sites in the body. This antibody plays a crucial role in regulating the immune response by inhibiting the signaling pathway of cytokines such as interferons and interleukins. By blocking these signals, it helps prevent excessive inflammation and damage to cells and tissues.</p>

<p>CA11 antibody was raised in Rabbit using Human CA11 as the immunogen</p>

<p>Rabbit polyclonal MAP3K7 antibody (Thr187)</p>

<p>DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY</p>

<p>Rabbit polyclonal POLR2A antibody (Ser1619)</p>

<p>EIF1AX antibody was raised using the middle region of EIF1AX corresponding to a region with amino acids KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD</p>

<p>FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA</p>

<p>Purified Polyclonal GPR25 antibody</p>

<p>Rabbit polyclonal APC5 antibody (HRP)</p>

<p>The HUR antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody is specifically designed to target and neutralize influenza hemagglutinin, a protein found on the surface of the influenza virus. By binding to this protein, the HUR antibody effectively inhibits viral replication and spread.</p>

<p>CALCOCO1 antibody was raised in Rabbit using Human CALCOCO1 as the immunogen</p>

<p>GNB3 antibody was raised in Rabbit using Human GNB3 as the immunogen</p>

<p>Purified Polyclonal Caspase 5 p20 antibody</p>

<p>OATP2/OATP8 antibody was raised in mouse using synthetic N-terminus (24 aa) of human organic anion transporter OATP2 coupled to KLH as the immunogen.</p>

<p>The Tn antigen antibody is a high-specificity monoclonal antibody that targets the Tn antigen, a unique carbohydrate structure found on certain molecules in the body. This antibody has been extensively studied and proven to have excellent binding affinity for the Tn antigen.</p>

<p>Rabbit polyclonal Kinase E2 antibody</p>

<p>The ETS1 antibody is a highly specialized monoclonal antibody that has been developed for use in various research applications. It specifically targets and neutralizes the activated form of ETS1, a transcription factor that plays a critical role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK</p>

<p>GHRL antibody was raised in Rabbit using Human GHRL as the immunogen</p>

<p>Rabbit polyclonal SSFA2 antibody</p>

<p>Rabbit Polyclonal KIF13B antibody</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>Rabbit polyclonal MSK1 antibody</p>

<p>The PLK1 antibody is a highly specialized monoclonal antibody that targets the polo-like kinase 1 (PLK1) protein. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Purified Polyclonal Carbonic Anhydrase 2 antibody</p>

<p>Mouse monoclonal PPM1F antibody</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>The MHC Class II antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes MHC Class II molecules. These molecules play a crucial role in the immune response by presenting antigens to T cells, thereby initiating an immune response. The MHC Class II antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It has been shown to effectively stain actin filaments, growth factors, collagen, glycoproteins, fibrinogen, and other cellular components. Additionally, this antibody has been used to study the role of MHC Class II molecules in various biological processes including antigen presentation and cytokine production. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related diseases.</p>

<p>The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.</p>

<p>Rat monoclonal Rat anti-Mouse IgA antibody (FITC)</p>

<p>Rat monoclonal CIRE antibody (allophycocyanin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser213)</p>

<p>Armenian Hamster monoclonal CD69 antibody (PE)</p>

<p>Rabbit polyclonal JAK2 antibody (Tyr931)</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>INTS12 antibody was raised in Rabbit using Human INTS12 as the immunogen</p>

<p>IARS2 antibody was raised in Rabbit using Human IARS2 as the immunogen</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>

<p>The TF antibody is a highly specialized monoclonal antibody that is used for various applications in research and diagnostics. This antibody specifically recognizes the TF antigen, which is a carbohydrate structure found on the surface of cells. The TF antibody can be used in immunoassays, such as ELISA or Western blotting, to detect the presence of TF antigen in samples.</p>

<p>Purified Polyclonal EGVEGF antibody</p>

<p>ETV5 antibody was raised in Mouse using a purified recombinant fragment of human ETV5 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal CD163 antibody (biotin)</p>

<p>The USP5 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of neutralizing monoclonal antibodies that target TGF-beta protein. This antibody is specifically designed to bind to and neutralize TGF-beta, a growth factor involved in various cellular processes.</p>

<p>The RBP1 antibody is a growth factor that has been shown to play a role in thrombocytopenia. It is commonly used in Life Sciences research and can be utilized in various experimental techniques, such as electrode-based assays. This trifunctional antibody is capable of binding to human serum and activating specific pathways. It can also be used as a tool for the detection and quantification of other antibodies or antigens. The RBP1 antibody has genotoxic effects on cells, making it useful for studying DNA damage and repair mechanisms. Additionally, it acts as an inhibitor of phosphatase activity and chemokine signaling. This Monoclonal Antibody specifically targets tyrosine kinase receptors and protein kinases, making it an essential tool for researchers in the field of molecular biology.</p>

<p>HNRNPA2B1 antibody was raised in Rabbit using Human HNRNPA2B1 as the immunogen</p>

<p>CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII</p>

<p>The LOX antibody is a low-molecular-weight monoclonal antibody with immunosuppressant properties. It contains a cycloalkyl group that specifically targets lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has the ability to neutralize interferon and other growth factors, making it an effective antiviral agent. Additionally, the LOX antibody has been shown to have a high affinity for alpha-fetoprotein, a marker commonly found in certain types of cancer cells. With its neutralizing capabilities and targeted approach, this monoclonal antibody is a valuable tool in the field of life sciences and holds great potential for therapeutic applications.</p>

<p>Rabbit Polyclonal LEPREL2 antibody</p>

<p>Mouse monoclonal PSMB4 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Additionally, it has been proven to have high efficacy in human erythrocytes using a patch-clamp technique. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal TP53I3 antibody</p>

<p>SDSL antibody was raised using the N terminal of SDSL corresponding to a region with amino acids MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR</p>

<p>Rabbit polyclonal ZNF480 antibody</p>

<p>GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI</p>

<p>Mouse monoclonal MHC Class I H2Kk antibody (biotin)</p>

<p>LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG</p>

<p>KIF22 antibody was raised in mouse using recombinant Human Kinesin Family Member 22 (Kif22)</p>

<p>Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC</p>

<p>Rabbit polyclonal GNAL antibody</p>

<p>Phenobarbital antibody was raised in mouse using phenobarbital-KLH conjugate as the immunogen.</p>

<p>Rabbit polyclonal p53 antibody (biotin)</p>

<p>The ZFP36 antibody is a powerful tool in the field of medicine. It is an autoantibody that specifically targets and binds to the ZFP36 protein, which plays a crucial role in nuclear regulation. This antibody can be used in various assays and experiments to study the function and localization of ZFP36.</p>

<p>Rabbit polyclonal CENTB1 antibody (Ser554)</p>

<p>Purified Rabbit polyclonal OR2J2 antibody</p>

<p>Mouse monoclonal TNNI3 antibody</p>

<p>INTS3 antibody was raised in Rabbit using Human INTS3 as the immunogen</p>

<p>Rabbit polyclonal SYTL4 antibody</p>

<p>CCDC28A antibody was raised in Rabbit using Human CCDC28A as the immunogen</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>Mouse monoclonal ERCC4 antibody</p>

<p>Purified Rabbit polyclonal PGRMC2 antibody</p>

<p>The SATB1 antibody is a high-flux monoclonal antibody that has antiviral properties. It is commonly used in assays to detect the presence of interleukins and other antigens. This antibody is also used in the development of polyclonal antibodies, which are important tools in biomedical research. In addition, the SATB1 antibody can be used as a serum marker for various diseases and conditions. Its affinity for binding to specific targets makes it an essential component in many life sciences applications. Whether you're conducting experiments or developing new medicaments, this SATB1 antibody will provide reliable and accurate results.</p>

<p>Rat monoclonal 41BB Ligand antibody (biotin)</p>

<p>Mouse monoclonal DSTN antibody</p>

<p>The Cytokeratin 18 antibody is a diagnostic reagent that specifically targets the protein complex known as cytokeratin 18. This antibody is designed to detect and bind to cytokeratin 18, which is a type of intermediate filament protein found in epithelial cells. The antibody can be used for various applications, including immunohistochemistry and Western blotting, to study the expression and localization of cytokeratin 18 in different tissues and cell types. It is available as both polyclonal antibodies and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, the Cytokeratin 18 antibody is an essential tool for studying epithelial cell biology and diagnosing certain diseases related to cytokeratin 18 expression.</p>

<p>Rabbit polyclonal RPP40 antibody</p>

<p>Mouse monoclonal Cytokeratin AE1+AE3 antibody</p>

<p>PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP</p>

<p>Rabbit polyclonal RPS6KA2 antibody</p>

<p>Purified Polyclonal CD158b1 antibody</p>