Anticuerpos primarios

<p>Affinity purified Rabbit polyclonal HSD17B1 antibody</p>

<p>CNDP1 antibody was raised in rabbit using the C terminal of CNDP1 as the immunogen</p>

<p>LRCH3 antibody was raised in Rabbit using Human LRCH3 as the immunogen</p>

<p>Rabbit polyclonal MYF6 antibody</p>

<p>Rabbit polyclonal AZI1 antibody</p>

<p>Rabbit Polyclonal GIMAP4 antibody</p>

<p>Rabbit polyclonal RPL36 antibody</p>

<p>The SEMA4A antibody is a polyclonal antibody that specifically targets the protein SEMA4A, which belongs to the family of costimulatory molecules. This antibody can be used in various life sciences applications, including immunomodulatory research and dendritic cell studies. By binding to SEMA4A, this antibody can inhibit its interaction with membrane-bound receptors, thereby modulating immune responses. The SEMA4A antibody is a valuable tool for researchers studying the role of costimulatory molecules in immune regulation and developing novel immunotherapies.</p>

<p>PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA</p>

<p>Rabbit polyclonal PLSCR4 antibody</p>

<p>Rabbit Polyclonal CHST6 antibody</p>

<p>LBP antibody was raised in Rabbit using Human LBP as the immunogen</p>

<p>Mouse monoclonal CST2 antibody</p>

<p>Rabbit polyclonal BDNF antibody (HRP)</p>

<p>The HDAC1 antibody is a highly specialized monoclonal antibody that targets the histone deacetylase 1 enzyme. This enzyme plays a crucial role in regulating gene expression by removing acetyl groups from histone proteins, thereby affecting chromatin structure and transcriptional activity. The HDAC1 antibody specifically binds to HDAC1 and inhibits its function, leading to increased acetylation of histones and altered gene expression patterns.</p>

<p>SLU7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH</p>

<p>Cytokeratin 9 antibody was raised in mouse using synthetic peptides of human cytokeratin 9 as the immunogen.</p>

<p>The GAD67 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for studying the role of glutamate and the neurotransmitter gamma-aminobutyric acid (GABA) in various biological processes. This antibody specifically targets glutamic acid decarboxylase 67 (GAD67), an enzyme involved in the synthesis of GABA.</p>

<p>P2RX2 antibody was raised using the middle region of P2RX2 corresponding to a region with amino acids IRIDVIVHGQAGKFSLIPTIINLATALTSVGVVRNPLWGPSGCGGSTRPL</p>

<p>Rabbit polyclonal PSMB1 antibody (biotin)</p>

<p>CD5 antibody was raised in mouse using human CD5 as the immunogen.</p>

<p>The HRH2 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has been specifically designed to neutralize the activity of the HRH2 protein, which plays a crucial role in various cellular processes. The HRH2 antibody is capable of inhibiting the lysis of β-catenin and fibronectin, two proteins involved in cell adhesion and signaling pathways.</p>

<p>The NOTCH4 antibody is a polyclonal antibody that is used in Life Sciences research. It has the ability to neutralize the activity of NOTCH4, a protein involved in various cellular processes including cell proliferation, differentiation, and apoptosis. The NOTCH4 antibody can be used to study the role of NOTCH4 in different biological processes such as development, tissue regeneration, and cancer progression. Additionally, this antibody has been shown to have potential therapeutic applications in diseases associated with abnormal NOTCH4 signaling, such as certain types of cancer and autoimmune disorders. Its high specificity and affinity make it a valuable tool for researchers studying the molecular mechanisms underlying these diseases.</p>

<p>Rabbit polyclonal MYF5 antibody</p>

<p>FAM72A antibody was raised in Rabbit using Human FAM72A as the immunogen</p>

<p>The PAX4 antibody is a highly specific monoclonal antibody with a wide range of applications in the field of Life Sciences. It exhibits high specific activity and has been extensively characterized for its binding properties. This antibody can be used in various research studies, including the detection and quantification of alpha-fetoprotein, lipoprotein lipase, low-density lipoprotein, fatty acids, and other biomolecules.</p>

<p>Rabbit polyclonal IFNG antibody (HRP)</p>

<p>MKNK1 antibody was raised in rabbit using the N terminal of MKNK1 as the immunogen</p>

<p>Mouse monoclonal SLC2A5 antibody</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>GLB1 antibody was raised in Rabbit using Human GLB1 as the immunogen</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal GCLM antibody</p>

<p>Donkey anti-mouse IgG (H + L) (HRP) was raised in donkey using murine IgG (H&amp;L) as the immunogen.</p>

<p>Rabbit polyclonal NR4A1 antibody (Ser351)</p>

<p>Affinity purified Rabbit polyclonal CaMK1D antibody</p>

<p>CD3 antibody was raised in mouse using chicken CD3 as the immunogen.</p>

<p>FOXO4 antibody was raised in Rabbit using Human FOXO4 as the immunogen</p>

<p>Mouse monoclonal PA28 gamma antibody</p>

<p>Mouse monoclonal Toll-like receptor 1 antibody (PE)</p>

<p>Rabbit polyclonal Collagen XIII alpha 1 antibody</p>

<p>Rabbit Polyclonal hnRPD antibody (Ser83)</p>

<p>MRAS antibody was raised in Rabbit using Human MRAS as the immunogen</p>

<p>XRCC3 antibody was raised in rabbit using the C terminal of XRCC3 as the immunogen</p>

<p>Rabbit polyclonal RBMX2 antibody</p>

<p>Affinity purified Rabbit polyclonal hnRNP C1/C2 antibody</p>

<p>Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE</p>

<p>Rabbit polyclonal REEP6 antibody</p>

<p>Purified Rabbit polyclonal ZNF816A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity and is highly effective in treating tuberculosis infections. This active compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>MED12 antibody was raised in Rabbit using Human MED12 as the immunogen</p>

<p>C6ORF201 antibody was raised using the N terminal Of C6Orf201 corresponding to a region with amino acids PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG</p>

<p>Rabbit polyclonal Lpa12 antibody</p>

<p>PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP</p>

<p>Rabbit polyclonal CASR antibody (Thr888)</p>

<p>Affinity purified Rabbit polyclonal DENND1B antibody</p>

<p>Rabbit polyclonal PE2R2 antibody</p>

<p>Affinity purified Rabbit polyclonal Kininogen 1 antibody</p>

<p>HMGB2 antibody was raised in Rabbit using Human HMGB2 as the immunogen</p>

<p>Rabbit polyclonal OR2AP1 antibody</p>

<p>HIST1H1E antibody was raised using the N terminal of HIST1H1E corresponding to a region with amino acids MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAA</p>

<p>Purified Polyclonal IKK alpha antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The FAM84B antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets FAM84B, an important protein involved in various biological processes. This antibody has been extensively studied and validated for its efficacy and specificity.</p>

<p>The ATF2 antibody is a high-quality polyclonal antibody that specifically targets and neutralizes the activity of ATF2, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and efficacy. It binds to ATF2 with high affinity, inhibiting its function and preventing its interaction with other proteins.</p>

<p>Rabbit polyclonal TICAM2 antibody</p>

<p>Rabbit polyclonal TEKT2 antibody</p>

<p>Rabbit polyclonal PDK1 antibody (Tyr9)</p>

<p>The Lck antibody is a powerful cytotoxic agent that targets TGF-β1, a protein involved in cell growth and differentiation. It is a polyclonal antibody that can be used in various life science applications. The Lck antibody has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other growth factors, making it an effective tool for studying cell signaling pathways. Additionally, this antibody can be used as a monoclonal antibody to specifically target and neutralize Lck, a tyrosine kinase involved in T-cell activation. Its specificity towards Lck makes it an invaluable tool for researchers studying immune responses and related diseases.</p>

<p>The ACAT1 antibody is a colloidal antibody that is used in various life science applications. It specifically targets and binds to the ACAT1 protein, which is involved in cholesterol metabolism and lipid storage. This antibody can be used for research purposes, such as studying the role of ACAT1 in cellular processes or as a diagnostic tool for detecting the presence of ACAT1 in biological samples. The ACAT1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. It has been validated for use in various assays, including immunofluorescence (IF), immunohistochemistry (IHC), western blotting (WB), and enzyme-linked immunosorbent assay (ELISA). With its high specificity and sensitivity, the ACAT1 antibody is a valuable tool for investigating the function and regulation of ACAT1 in different biological systems.</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>Plasmodium vivax antibody is a Monoclonal Antibody that specifically targets the adeno-associated virus (AAV) oncogene homolog in Plasmodium vivax. It has been developed for use in bioassays and research in the Life Sciences field. This antibody binds to the target molecule, inhibiting its activity and preventing the growth and replication of Plasmodium vivax. The antibody complex formed by Plasmodium vivax antibody has shown efficacy in inhibiting caspase-9, an enzyme involved in apoptosis, and reducing steroid levels in human serum. Additionally, this antibody has potential applications in targeting other parasitic organisms such as Cryptosporidium. With its high specificity and potent inhibitory effects, Plasmodium vivax antibody is a valuable tool for researchers studying parasitic infections and developing new therapeutic strategies.</p>

<p>Purified Rabbit polyclonal MPHOSPH9 antibody</p>

<p>HBcAg antibody was raised in mouse using recombinant HBcAg as the immunogen.</p>

<p>Rabbit polyclonal ZNF266 antibody</p>

<p>KCNH7 antibody was raised in Rabbit using Human KCNH7 as the immunogen</p>

<p>C21ORF56 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVV</p>

<p>CFTR antibody is an antibody that specifically targets the cystic fibrosis transmembrane conductance regulator (CFTR) protein. CFTR is involved in the transport of chloride ions across cell membranes, and mutations in this protein can lead to cystic fibrosis. This antibody can be used in various Life Sciences applications, such as immunohistochemistry and Western blotting, to study the expression and localization of CFTR. It has been shown to bind to CFTR with high specificity and sensitivity. Additionally, this antibody has been used to investigate the role of CFTR in various biological processes, including collagen synthesis, hyaluronidase activity, and microvessel density regulation. Its ability to detect glycoproteins and growth factors makes it a valuable tool for studying cellular signaling pathways involving CFTR.</p>

<p>Mouse monoclonal CD45R antibody (biotin)</p>

<p>Rabbit polyclonal UHMK1 antibody</p>

<p>Rabbit polyclonal PIR antibody</p>

<p>The STAT5B antibody is a highly specialized product used in the field of Life Sciences. It is designed to specifically target and inhibit the activity of STAT5B, a nuclear protein involved in various cellular processes. This antibody has been extensively tested and validated for its effectiveness in blocking the function of STAT5B.</p>

<p>Purified Polyclonal CD104 antibody</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>Purified Polyclonal AMPK gamma 1 antibody</p>

<p>MRPS21 antibody was raised in Rabbit using Human MRPS21 as the immunogen</p>

<p>Serratia marcescens Monoclonal Antibody</p>

<p>Mouse monoclonal NEUROG1 antibody</p>

<p>The NQO1 Antibody is a highly specialized collagen-based monoclonal antibody that targets the NAD(P)H:quinone oxidoreductase 1 (NQO1) enzyme. This antibody plays a crucial role in various biological processes, including lipoprotein lipase activity, globulin metabolism, and amide hydrolysis. It has been extensively used in Life Sciences research to study the function of NQO1 and its involvement in cellular pathways.</p>

<p>CRTC2 antibody was raised in Mouse using a purified recombinant fragment of human CRTC2 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal ATP6V1H antibody</p>

<p>INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK</p>

<p>C21orf66 antibody was raised in Rabbit using Human C21orf66 as the immunogen</p>

<p>Armenian Hamster monoclonal CD61 antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive testing using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The Anti-Müllerian hormone antibody is a neurotrophic factor used in Life Sciences research. This monoclonal antibody has inhibitory properties and is capable of neutralizing the effects of tumor necrosis factor-alpha (TNF-α), insulin, and other molecules. It is commonly used in immunoassays to detect and measure the levels of these substances in biological samples. The Anti-Müllerian hormone antibody can also activate natriuretic peptide receptors and protein kinase pathways, making it a versatile tool for studying various signaling pathways in cells. Additionally, this antibody has been shown to have binding affinity for transforming growth factor-beta 1 (TGF-β1), further expanding its applications in research and diagnostics.</p>

<p>LYPLAL1 antibody was raised in Rabbit using Human LYPLAL1 as the immunogen</p>

<p>The ABL1 antibody is a highly specialized monoclonal antibody that specifically targets and neutralizes the activity of ABL1 protein. This protein is involved in various cellular processes, including cell growth, differentiation, and division. The ABL1 antibody has been extensively studied and proven to be effective in inhibiting the activity of ABL1, making it an important tool for researchers in the field of Life Sciences.</p>

<p>CAMKK1 antibody was raised in rabbit using the C terminal of CAMKK1 as the immunogen</p>

<p>The BAD antibody is an activated antibody that exhibits pro-apoptotic activity. It plays a crucial role in cell lipid metabolism and is widely used in the field of Life Sciences for various applications. This polyclonal antibody can be synthesized in vitro and is commonly used in research studies to investigate the effects of taxane chemotherapy and other cytotoxic treatments on cell survival. The BAD antibody targets proteins such as bcl-2 and rituximab, which are involved in regulating apoptosis. By promoting pro-apoptotic activity, this antibody can enhance the efficacy of cytotoxic treatments and potentially improve patient outcomes. With its high specificity and affinity for its target molecules, the BAD antibody is a valuable tool for researchers studying cell death pathways and developing novel therapeutic strategies.</p>

<p>Rabbit polyclonal UQCRQ antibody (biotin)</p>

<p>Purified Polyclonal GPR173 antibody</p>

<p>Purified Polyclonal Trypsin 3 antibody</p>

<p>Mouse monoclonal KCNJ3 antibody</p>

<p>Rabbit polyclonal CCL2 antibody (FITC)</p>

<p>HSV6 gp90 antibody was raised in mouse using 90 KDa glycoprotein of HHV6 as the immunogen.</p>

<p>C17orf28 antibody was raised in Rabbit using Human C17orf28 as the immunogen</p>

<p>ApoM antibody was raised in Mouse using a purified recombinant fragment of human ApoM expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal RPS16 antibody (biotin)</p>

<p>Rabbit polyclonal SLFNL1 antibody</p>

<p>Rabbit polyclonal b-cat antibody</p>

<p>Purified Polyclonal Cytochrome P450 2A6 antibody</p>

<p>UBLCP1 antibody was raised using the N terminal of UBLCP1 corresponding to a region with amino acids MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV</p>

<p>Rat monoclonal Ly6A/E antibody (PE)</p>

<p>Rabbit polyclonal Chl56 antibody</p>

<p>Purified Polyclonal FRS3 antibody</p>

<p>Defensin beta 2 antibody is a glycosylated monoclonal antibody that has neuroprotective properties. It belongs to the class of antibodies known as monoclonal antibodies, which are used in various fields such as Life Sciences and antiviral research. This antibody specifically targets defensin beta 2, a naturally occurring peptide involved in immune response and defense against pathogens.</p>

<p>Rabbit polyclonal cRAF antibody (Ser289)</p>

<p>Mouse monoclonal anti human GARS antibody</p>

<p>Rabbit polyclonal DARPP32 antibody (Thr34)</p>

<p>Rabbit polyclonal PKR antibody (Thr451)</p>

<p>Mouse monoclonal CD90.1 antibody (FITC)</p>

<p>Mouse monoclonal SHPRH antibody</p>

<p>Rabbit polyclonal PDK2 antibody</p>

<p>RIC8B antibody was raised using a synthetic peptide corresponding to a region with amino acids HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL</p>

<p>RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG</p>

<p>Mouse monoclonal CST2 antibody</p>

<p>D-dimer antibody is a monoclonal antibody that specifically binds to D-dimer, a fibrin degradation product. It is commonly used in laboratory tests to detect the presence of blood clots or to monitor anticoagulant therapy. The D-dimer antibody can be immobilized on an electrode surface for use in electrochemical assays. This antibody has shown high specificity and sensitivity in detecting D-dimer levels, making it a valuable tool in the field of life sciences. Additionally, the D-dimer antibody can be used as an antagonist to block the binding of growth factors such as epidermal growth factor (EGF) or monoclonal antibodies like trastuzumab, providing potential therapeutic applications. Its stability and resistance to freeze-thaw cycles make it suitable for various research and diagnostic purposes.</p>

<p>Syrian Hamster monoclonal NK cell antibody (biotin)</p>

<p>Rabbit polyclonal RPL36AL antibody (FITC)</p>

<p>The BAG3 antibody is a polyclonal antibody that has been widely used in life sciences research. It is a valuable tool for studying microvessel density and the effects of tumor necrosis factor-alpha (TNF-α) on various cellular processes. This antibody specifically targets BAG3, which is involved in multiple cellular functions such as protein folding, cell survival, and apoptosis. The BAG3 antibody can be used in immunohistochemistry, Western blotting, and other applications to explore the role of BAG3 in different biological systems. Its high specificity and sensitivity make it an essential reagent for researchers studying growth factors, colony-stimulating factors, and other signaling pathways related to BAG3. Whether you are investigating the mechanisms of disease or developing new therapeutic strategies, the BAG3 antibody will provide valuable insights into your research.</p>

<p>NFKB1 antibody was raised in rabbit using the middle region of NFKB1 as the immunogen</p>

<p>Rabbit Polyclonal OR2J3 antibody</p>

<p>The ACTA1 antibody is a highly specialized monoclonal antibody that targets the ACTA1 protein. This protein is involved in various cellular processes, including fatty acid metabolism and growth factor signaling. The ACTA1 antibody specifically binds to the ACTA1 protein, allowing for its detection and analysis in various experimental settings.</p>

<p>The KLK3 antibody is an activated amino functional chemokine that plays a crucial role in various biological processes. It is involved in the regulation of adenosine triphosphate (ATP) and TGF-beta signaling pathways, as well as acting as a chemoattractant protein for monocytes. This monoclonal antibody is widely used in life sciences research and has shown promising results in neutralizing the effects of red ginseng and botulinum toxin. Additionally, it has been found to modulate mitogen-activated protein (MAP) kinase signaling pathways. The KLK3 antibody offers a valuable tool for studying cellular processes and exploring potential therapeutic applications in various fields.</p>

<p>EFEMP2 antibody was raised in Rabbit using Human EFEMP2 as the immunogen</p>

<p>Rabbit polyclonal Orosomucoid antibody (FITC)</p>

<p>Rabbit polyclonal STAT5A/B antibody</p>

<p>Rabbit polyclonal LATS2 antibody</p>

<p>The HSPG2 antibody is a monoclonal antibody that specifically targets collagen and inhibits the activity of tyrosinase. This antibody has been shown to have inhibitory effects on factors involved in autoimmune diseases, such as calpastatin and anti-acth antibodies. Additionally, it has been used in life sciences research to study the role of HSPG2 in insulin signaling and tyrosine phosphorylation. The HSPG2 antibody is a valuable tool for researchers studying various aspects of cellular function and autoimmune disorders.</p>

<p>Mouse monoclonal RAB17 antibody</p>

<p>RBM28 antibody was raised using the C terminal of RBM28 corresponding to a region with amino acids QTKAEVEQVELPDGKKRRKVLALPSHRGPKIRLRDKGKVKPVHPKKPKPQ</p>

<p>GPC4 antibody was raised in Rabbit using Human GPC4 as the immunogen</p>

<p>The CD102 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been shown to be effective in detecting β-catenin expression in various tissues, including liver microsomes. Additionally, the CD102 antibody has anti-beta amyloid properties, making it useful for studying neurodegenerative diseases such as Alzheimer's. It also exhibits growth factor activity and can activate caspase-9, an enzyme involved in apoptosis. This antibody has antiviral properties and can inhibit the replication of certain viruses. The CD102 antibody is commonly used in immunoassays to detect the presence of β-catenin and can also be used to study polymerase activity and proteolytic processes. Its acidic nature allows for optimal binding to nuclear factor kappa-light-chain-enhancer regions.</p>

<p>The Pirimiphos antibody is a highly effective antibody-drug that specifically targets TNF-α, a cytokine involved in inflammation and immune response. This polyclonal antibody is widely used in Life Sciences research to study the role of TNF-α and its receptor in various biological processes. It can be used for applications such as immunohistochemistry and Western blotting to detect and quantify TNF-α expression levels. The Pirimiphos antibody can also be conjugated with other molecules, such as doxorubicin, to create targeted therapies for specific diseases. With its high specificity and affinity, this monoclonal antibody offers a powerful tool for researchers studying growth factors, kinases, phosphatases, and carbonyl reductases. Its cytotoxic properties make it an ideal candidate for therapeutic applications aimed at eliminating cells expressing TNF-α.</p>

<p>Rabbit polyclonal SERINC1 antibody</p>

<p>HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI</p>

<p>Rabbit polyclonal ARF5 antibody (HRP)</p>

<p>PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL</p>

<p>Affinity purified Rabbit polyclonal Glycerol kinase 2 antibody</p>

<p>CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE</p>

<p>Rat monoclonal CD41 antibody (allophycocyanin)</p>

<p>The Gentamicin monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to low-density activated collagen, inhibiting its activity. By blocking the interaction between collagen and its inhibitors, this antibody helps to regulate various biological processes. Additionally, it has been shown to have a high affinity for galectin-3-binding sites, which play a crucial role in endocytic uptake and interferon signaling.</p>

<p>KLHDC8B antibody was raised using the N terminal of KLHDC8B corresponding to a region with amino acids MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE</p>

<p>CA1 antibody was raised in Rabbit using Human CA1 as the immunogen</p>

<p>TREM2 antibody was raised in mouse using recombinant human TREM2 (19-161aa) purified from E. coli as the immunogen.</p>

<p>Rabbit Polyclonal GABRG1 antibody</p>

<p>CHCHD4 antibody was raised using the N terminal of CHCHD4 corresponding to a region with amino acids MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN</p>

<p>The RRP1 antibody is a polyclonal antibody that is widely used in the field of life sciences. It specifically targets the 6-phosphogluconate dehydrogenase (PGD) protein and has been shown to be an effective HDAC inhibitor. The antibody recognizes a phosphorylation site on the PGD protein, making it a valuable tool for studying post-translational modifications. Additionally, the RRP1 antibody can be used to detect and quantify the levels of PGD in various biological samples. Its high specificity and sensitivity make it an ideal choice for researchers working with retinoid signaling pathways, sirtuins, antinociceptive mechanisms, methyl transferases, and collagen activation. With its wide range of applications, the RRP1 antibody is an essential tool for any researcher in need of reliable and accurate detection of PGD protein expression.</p>

<p>DDB1 antibody was raised in Rabbit using Human DDB1 as the immunogen</p>

<p>PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP</p>

<p>The PEPD antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and detects PEPD, which is an enzyme involved in adipose tissue metabolism. This antibody is widely used in research studies related to adipose tissue, autoantibodies, amyloid plaque formation, and lipase activity.</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>The GATA4 antibody is a highly specific monoclonal antibody that has been widely used in life sciences research. It targets the GATA4 protein, which plays a crucial role in various cellular processes such as cell differentiation and proliferation. This antibody has been extensively validated for its specificity and sensitivity in various applications including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>The API5 antibody is an adeno-associated polypeptide that has the ability to bind to antigenic proteins and inhibit their activity. It is commonly used as a research tool in the development of inhibitors for various diseases. The API5 antibody has been shown to have a high affinity for heparin, which makes it an effective compound for inhibiting heparin cofactor activity. Additionally, this antibody can be used in the production of polyclonal antibodies, which are essential tools in biomedical research. It is also known to have autoantibodies properties and can be utilized in the development of medicines targeting serotonin-related disorders.</p>

<p>The PERK antibody is a polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the activated form of PERK (protein kinase RNA-like endoplasmic reticulum kinase). This monoclonal antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>FA2H antibody was raised in Rabbit using Human FA2H as the immunogen</p>

<p>SAMD14 antibody was raised using the N terminal of SAMD14 corresponding to a region with amino acids HKARAQLLAKGRRHRPSRSRLRDSASSAEDGEGSDGPGGKVTDGCGSPLH</p>

<p>Tuberin antibody is a polyclonal antibody that specifically targets tuberin, a protein involved in the regulation of cell growth and proliferation. This antibody is commonly used in life sciences research to study the role of tuberin in various cellular processes. It has been shown to bind to tyrosine-phosphorylated tuberin and inhibit its interaction with other proteins, such as interleukins and insulin-like growth factors. Tuberin antibody is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their experiments. It can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. This antibody is immobilized on a solid support, making it easy to use for protein-protein interaction studies or detection of tuberin in complex samples. Tuberin antibody is highly specific and sensitive, ensuring accurate and reliable results in your research.</p>

<p>DNAJC7 antibody was raised in Rabbit using Human DNAJC7 as the immunogen</p>

<p>The TIMP2 antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing molecule. It is a neutralizing antibody that has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting endothelial growth and angiogenesis, making it a valuable tool for research in the field of cancer biology and tumor development. Additionally, the TIMP2 antibody has been used to detect alpha-fetoprotein levels in human serum, making it an important tool for diagnostic purposes. With its high specificity and affinity for its target molecule, this antibody offers great promise for further advancements in the understanding and treatment of various diseases.</p>

<p>The ICAM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to ICAM1, which stands for Intercellular Adhesion Molecule 1. This protein plays a crucial role in cell adhesion and immune response regulation. The binding of the ICAM1 antibody to ICAM1 can inhibit various cellular processes, including the activation of β-catenin, endonuclease activity, and the production of mitogen-activated protein (MAP) kinases such as p38 MAP kinase.</p>

<p>EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP</p>

<p>HEXA antibody is a highly specific and potent polyclonal antibody used in life sciences research. It is also available as a monoclonal antibody. This antibody specifically targets the natriuretic hormone peptide, TGF-beta, and has neutralizing properties. It can be used to study the role of these hormones in various biological processes. Additionally, HEXA antibody has cytotoxic effects on cells expressing certain growth factors, making it a valuable tool for studying cell signaling pathways. Moreover, this antibody can be used in studies related to lipid metabolism as it targets enzymes such as triglyceride lipase and lipoprotein lipase. Its wide range of applications makes HEXA antibody an essential component of any research project in the fields of life sciences and medicine.</p>

<p>CD49e antibody was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/10 as the immunogen.</p>

<p>KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK</p>

<p>RORC antibody was raised in mouse using recombinant Human Rar-Related Orphan Receptor C</p>

<p>The Cofilin antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein cofilin, which plays a crucial role in cell movement and cytoskeletal dynamics. By binding to cofilin, this antibody allows researchers to study its function and regulation in various cellular processes.</p>

<p>Mouse monoclonal TRAP1 antibody</p>

<p>Mouse monoclonal CD23 antibody (PE)</p>

<p>MTOR antibody was raised in Rabbit using Human MTOR as the immunogen</p>

<p>Affinity purified Rabbit polyclonal COUP TF1 antibody</p>

<p>The ATF4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the ATF4 protein, which plays a crucial role in cellular response to stress and regulation of gene expression. This antibody has been extensively tested and validated for its specificity and inhibitory properties.</p>

<p>BHMT2 antibody was raised using the middle region of BHMT2 corresponding to a region with amino acids GFVDLPEYPFGLESRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRA</p>

<p>KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP</p>

<p>SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV</p>