Anticuerpos primarios

<p>Purified Rabbit polyclonal MRPS22 antibody</p>

<p>The PRDX1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets and binds to Peroxiredoxin-1 (PRDX1), a protein involved in various cellular processes such as antioxidant defense and cell signaling. This monoclonal antibody has been extensively studied for its therapeutic potential in diseases like cancer, diabetes, and cardiovascular disorders.</p>

<p>Flt1 antibody was raised in Mouse using purified recombinant extracellular fragment of human Flt1 fused with hIgGFc tag expressed in HEK293 cells as the immunogen.</p>

<p>DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD</p>

<p>Rabbit polyclonal RRAGA antibody (FITC)</p>

<p>Affinity purified Rabbit polyclonal DDX56 antibody</p>

<p>Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of ER expressed in E. coli as the immunogen.</p>

<p>NEK4 antibody was raised in mouse using recombinant Human Nima (Never In Mitosis Gene A)-Related Kinase 4</p>

<p>The IGF1R antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the insulin-like growth factor 1 receptor (IGF1R), which plays a crucial role in cell growth, differentiation, and survival. By binding to IGF1R, this antibody effectively blocks the activation of downstream signaling pathways involved in these processes.</p>

<p>Rabbit polyclonal PARVG antibody</p>

<p>Rabbit polyclonal ILKAP antibody</p>

<p>The CLEC14A antibody is a monoclonal antibody that acts as an inhibitor of the glycoprotein CLEC14A. This antibody specifically targets CLEC14A and can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting. It is commonly used in life sciences research to study the role of CLEC14A in different cellular processes.</p>

<p>The SUCNR1 antibody is a highly specialized antibody that is used in the field of Life Sciences. It has been extensively tested and proven to be effective in various applications. This monoclonal antibody specifically targets SUCNR1, a receptor that plays a crucial role in various biological processes.</p>

<p>STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG</p>

<p>PKC epsilon antibody is a polyclonal antibody that specifically targets the MERTK protein. This antibody is commonly used in life sciences research to study the role of MERTK in various cellular processes. MERTK is a receptor tyrosine kinase involved in the regulation of cell growth, survival, and differentiation. It plays a crucial role in the immune response, particularly in the clearance of apoptotic cells and antiviral defense mechanisms mediated by interferon signaling. The PKC epsilon antibody has been shown to be highly reactive and exhibits strong binding affinity towards MERTK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry analysis. Researchers can rely on this high-quality antibody to accurately detect and quantify MERTK expression levels in different tissues or cell types. Its specificity and reliability make it an invaluable tool for studying the function and regulation of MERTK in various biological processes.</p>

<p>KCNA2 antibody was raised in Rabbit using Human KCNA2 as the immunogen</p>

<p>CASP3 antibody was raised in rabbit using the C terminal of CASP3 as the immunogen</p>

<p>Mouse monoclonal IL4 antibody (PE)</p>

<p>IL19 antibody is a monoclonal antibody that targets interleukin-19 (IL-19), a protein involved in various inflammatory processes. IL-19 is known to play a role in the development of amyloid plaques, which are associated with Alzheimer's disease. This antibody specifically binds to IL-19 and inhibits its activity, potentially reducing inflammation and the formation of amyloid plaques. Additionally, IL19 antibody has been shown to inhibit the growth of cancer cells by targeting proteins such as mesothelin and E-cadherin. It may also have potential therapeutic applications in other diseases characterized by abnormal immune responses or inflammation. With its high specificity and efficacy, IL19 antibody is a valuable tool for researchers in the field of Life Sciences studying cytokine biology and developing novel therapies.</p>

<p>CBR3 antibody was raised in Rabbit using Human CBR3 as the immunogen</p>

<p>Norovirus antibody was raised in mouse using purified native norwalk virus, strain 8Flla as the immunogen.</p>

<p>ApoBEC3F antibody was raised using the N terminal of APOBEC3F corresponding to a region with amino acids MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD</p>

<p>The CD9 antibody is a monoclonal antibody that belongs to the class of antibodies known as polyclonal antibodies. It specifically targets CD9, a protein that is involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of fibroin and natriuretic factors. Additionally, it has been found to have anti-VEGF activity, which makes it a potential candidate for anti-angiogenic therapy. The CD9 antibody also plays a role in hormone regulation and has been shown to modulate endothelial growth. In liver microsomes, this antibody acts as an inhibitor of caspase-9, thus preventing apoptosis. Furthermore, it has been found to interact with fatty acids and β-catenin, suggesting its involvement in lipid metabolism and cell signaling pathways. Overall, the CD9 antibody is a versatile tool with diverse applications in research and pharmaceutical development.</p>

<p>OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE</p>

<p>Tat antibody was raised in rabbit using the C terminal of Tat as the immunogen</p>

<p>TNRC6A antibody was raised using the N terminal of TNRC6A corresponding to a region with amino acids RELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQ</p>

<p>Purified Polyclonal Serpin B7 antibody</p>

<p>The ZNF786 antibody is a monoclonal antibody that exhibits cytotoxic properties and interacts with interferon-gamma (IFN-gamma). It specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer. Additionally, it has shown promising results in targeting the circumsporozoite protein of the malaria parasite. The ZNF786 antibody is highly specific and exhibits strong binding affinity towards its target, making it a valuable tool for research and diagnostic purposes. With its ability to modulate nuclear signaling and growth factors, this antibody holds great potential for future therapeutic interventions.</p>

<p>Rabbit polyclonal HTR7 antibody</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>The RHO antibody is a powerful monoclonal antibody that specifically targets the HER2 growth factor. It is commonly used in cancer treatment to inhibit the growth and spread of tumors. This antibody works by binding to the HER2 receptor on cancer cells, preventing the activation of downstream signaling pathways that promote cell proliferation and survival.</p>

<p>The GRF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to dopamine, insulin, and insulin antibodies, allowing for precise detection and analysis of these molecules in various biological samples. The GRF1 antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rabbit polyclonal VSNL1 antibody</p>

<p>The CDH2 antibody is a growth factor that targets specific proteins involved in cell signaling pathways. It is commonly used in Life Sciences research to study the effects of various growth factors, such as trastuzumab and interferon, on cellular processes. This monoclonal antibody specifically binds to CDH2, a lysine-specific cell adhesion molecule, and inhibits its activity. The binding of the CDH2 antibody to CDH2 prevents the interaction of CDH2 with other binding proteins, thereby disrupting important cellular functions. This neutralizing effect has been demonstrated through spectrometric and electrode analysis. Additionally, the CDH2 antibody has shown potential as an effective therapeutic agent for targeting epidermal growth factor receptors and enhancing the immune response by promoting the production of antibodies and IFN-gamma.</p>

<p>Rabbit Polyclonal p53 antibody (Ser15)</p>

<p>AOX1 antibody was raised in Rabbit using Human AOX1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal OXSR1 antibody</p>

<p>Purified Polyclonal NUB1 antibody</p>

<p>The DCI antibody is a cytotoxic monoclonal antibody that specifically targets mesothelin, a protein expressed on the surface of certain cancer cells. It is used in Life Sciences research to study the role of mesothelin in various diseases and as a potential therapeutic target. The DCI antibody has been shown to inhibit the growth of cancer cells and induce cell death through multiple mechanisms. Additionally, it has been found to have low cross-reactivity with human serum proteins, minimizing potential side effects. This high-quality antibody is widely used in scientific research and holds great promise for future therapeutic applications.</p>

<p>Rabbit polyclonal TRP antibody (FITC)</p>

<p>CRABP1 antibody was raised in Rabbit using Human CRABP1 as the immunogen</p>

<p>GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF</p>

<p>HHV8 antibody was raised in mouse using recombinant human ORF73/HHV8 (122-329aa) purified from E. coli as the immunogen.</p>

<p>entB Monoclonal Antibody</p>

<p>Purified Polyclonal TSC22 antibody</p>

<p>Rabbit polyclonal RPA2 antibody (FITC)</p>

<p>Rabbit Polyclonal GPS2 antibody</p>

<p>Myostatin antibody was raised in Mouse using a purified recombinant fragment of Myostatin expressed in E. coli as the immunogen.</p>

<p>The STAC3 antibody is a recombinant antigen that has shown potential in the treatment of non-alcoholic steatohepatitis (NASH). This effective substance belongs to the class of antibodies, which are proteins that can specifically bind to certain molecules in the body. The STAC3 antibody has been tested as a test substance for its ability to inhibit protein kinase activity, an enzyme involved in various cellular processes. Inhibitors of protein kinases have been studied extensively in Life Sciences for their potential therapeutic applications.</p>

<p>RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI</p>

<p>Rabbit polyclonal SOCS5 antibody</p>

<p>P2RXL1 antibody was raised using the N terminal of P2RXL1 corresponding to a region with amino acids ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN</p>

<p>The XIAP antibody is a monoclonal antibody that specifically targets the X-linked inhibitor of apoptosis protein (XIAP). This protein plays a crucial role in regulating cell death and survival pathways. The XIAP antibody binds to XIAP, preventing its interaction with caspases and promoting apoptosis in cancer cells.</p>

<p>FAM127B antibody was raised in Rabbit using Human FAM127B as the immunogen</p>

<p>The p27Kip1 antibody is a highly specialized tool used in the field of Life Sciences. It is an activated electrode that specifically targets and binds to p27Kip1, a protein involved in cell cycle regulation. This monoclonal antibody is designed to recognize and bind to p27Kip1 with high affinity and specificity, making it an essential tool for researchers studying cellular processes.</p>

<p>Rabbit Polyclonal ATP5H antibody</p>

<p>Rabbit polyclonal PFD5 antibody</p>

<p>The HOXA1 antibody is a highly specialized antibody that is used in various research fields within the Life Sciences industry. This colloidal antibody is specifically designed to target and bind to the HOXA1 protein, which plays a crucial role in developmental processes and gene regulation.</p>

<p>GIMAP5 antibody was raised in Rabbit using Human GIMAP5 as the immunogen</p>

<p>Rabbit polyclonal DNA Polymerase lambda antibody</p>

<p>MCC antibody was raised in Rabbit using Human MCC as the immunogen</p>

<p>EPHB4 antibody was raised in Mouse using purified recombinant extracellular fragment of human EPHB4 fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.</p>

<p>NDE1 antibody was raised in Rabbit using Human NDE1 as the immunogen</p>

<p>DHX38 antibody was raised in Rabbit using Human DHX38 as the immunogen</p>

<p>Rabbit polyclonal Basigin antibody (FITC)</p>

<p>Rabbit polyclonal SMYD4 antibody</p>

<p>EXO1 antibody was raised in Rabbit using Human EXO1 as the immunogen</p>

<p>Rabbit polyclonal OR2T10 antibody</p>

<p>The BIN3 antibody is a highly specialized monoclonal antibody that acts as a neutralizing agent. It is designed to target specific proteins, such as EGF-like antibodies and anti-CD20 monoclonal antibodies, in various assays used in the field of Life Sciences. This antibody has shown efficacy in neutralizing activated sclerostin and glucose-6-phosphate inhibitors, making it a valuable tool for researchers and scientists working on understanding and developing treatments for various diseases and conditions. With its precise targeting capabilities, the BIN3 antibody offers great potential for advancing scientific knowledge and improving patient outcomes.</p>

<p>Mouse monoclonal CD11c antibody (biotin)</p>

<p>Rabbit polyclonal p53 antibody (Ser378)</p>

<p>Purified Rabbit polyclonal Caveolin 1 antibody (Tyr14)</p>

<p>Mouse monoclonal Hemopexin antibody (Biotin)</p>

<p>PABP Monoclonal Antibody BSA/Azide Free</p>

<p>The cMyc antibody is a monoclonal antibody that specifically targets the c-myc protein. This antibody has been shown to have bace1 inhibitory properties, which may be beneficial in the treatment of certain diseases. Additionally, it has a high affinity for 5-hydroxymethylcytosine, making it an effective diagnostic agent for detecting this DNA modification. The cMyc antibody is also known for its low density lipoprotein stabilization activity and neutralizing capabilities against cyanobacterial toxins. With its wide range of applications in life sciences, this antibody is a valuable tool for researchers and clinicians alike. Whether you need monoclonal or polyclonal antibodies, the cMyc antibody is a reliable choice for your research needs.</p>

<p>Rabbit Polyclonal JAK2 antibody (Tyr1007)</p>

<p>DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG</p>

<p>TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG</p>

<p>Purified Polyclonal IL28RA antibody</p>

<p>Rabbit Polyclonal G3BP1 antibody (Ser232)</p>

<p>Rabbit polyclonal PCDH11X antibody</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>IGF BP5 antibody was raised in rabbit using highly pure recombinant human IGF-BP5 as the immunogen.</p>

<p>HSD17B4 antibody was raised in Rabbit using Human HSD17B4 as the immunogen</p>

<p>The SMA antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP). It is activated to bind with high affinity to AFP, making it a valuable tool in various research and diagnostic applications. This antibody has been used in studies related to heparin-induced thrombocytopenia (HIT), where it has shown promising results in detecting HIT antibodies. Furthermore, the SMA antibody has also been utilized in research on β-catenin and epidermal growth factor (EGF) signaling pathways. It has been shown to inhibit the activity of β-catenin and block EGF-induced cell proliferation. Additionally, this antibody has been used in studies related to antiphospholipid antibodies and interferon signaling pathways. Its high specificity and affinity make it an essential tool for researchers in the field of Life Sciences.</p>

<p>Rat monoclonal Lymphotoxin beta Receptor antibody</p>

<p>Mouse Monoclonal Insulin antibody (Biotin)</p>

<p>HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET</p>

<p>The GNMT antibody is a monoclonal antibody that targets the enzyme glycine N-methyltransferase (GNMT). It has been shown to have various therapeutic applications, including the treatment of thrombocytopenia and certain types of cancer. The GNMT antibody specifically binds to GNMT and inhibits its activity, which can lead to the suppression of tumor growth and metastasis. Additionally, this antibody has shown potential in modulating the immune response by interfering with interferon signaling pathways and enhancing the cytotoxic effects of other immune cells. With its specificity and versatility, the GNMT antibody holds promise in the field of life sciences for both research and clinical applications.</p>

<p>MIER2 antibody was raised in Rabbit using Human MIER2 as the immunogen</p>

<p>Rabbit polyclonal TMED9 antibody</p>

<p>The HDAC3 antibody is a highly specific monoclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for various applications. This antibody binds to HDAC3, which is an enzyme involved in the regulation of gene expression through histone deacetylation. By targeting HDAC3, this antibody can disrupt its function and potentially inhibit cell growth.</p>

<p>Mouse monoclonal ZFAND2B antibody</p>

<p>DNAJC15 antibody was raised in Rabbit using Human DNAJC15 as the immunogen</p>

<p>Rabbit polyclonal NR2E3 antibody</p>

<p>Mouse monoclonal RPN1 antibody</p>

<p>The IFNGR antibody is a highly specific polyclonal antibody that targets the interferon gamma receptor (IFNGR). It is widely used in life sciences research to study the role of IFNGR in various cellular processes. This antibody exhibits high affinity and specificity for IFNGR, making it an excellent tool for detecting and quantifying IFNGR expression levels in different cell types.</p>

<p>Rabbit polyclonal ATP5D antibody (HRP)</p>

<p>Rabbit polyclonal FGF Receptor antibody (Tyr154)</p>

<p>Mouse monoclonal CALCOCO2 antibody</p>

<p>The PBR antibody is a highly specialized monoclonal antibody that targets the subtilisin/kexin type of activated antibodies. It is specifically designed to neutralize the hepatocyte growth factor and reactive growth factor in order to inhibit their cytotoxic effects. This antibody has been shown to effectively bind to angptl3, a protein involved in the regulation of mesenchymal stem cells. The PBR antibody is widely used in Life Sciences research for its ability to immobilize and bind proteins, making it an essential tool for studying various cellular processes. Additionally, polyclonal antibodies are also available for those looking for broader reactivity and versatility in their experiments.</p>

<p>PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHD</p>

<p>The APE1 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to beta amyloid, a protein associated with various neurological disorders such as Alzheimer's disease. This antibody has also shown promising results in detecting alpha-fetoprotein, a marker for certain types of cancer.</p>

<p>Purified Polyclonal Beta arrestin 1 antibody</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 23-29 of cTnI as the immunogen.</p>

<p>ERG antibody was raised in Rabbit using Human ERG as the immunogen</p>

<p>TIPRL antibody was raised in rabbit using the N terminal of TIPRL as the immunogen</p>

<p>Rabbit polyclonal Rab1A antibody (HRP)</p>

<p>TRP2 antibody is a specific antibody that targets the extracellular antigen TRP2. It is commonly used as a serum marker in various medical applications, including cancer research and diagnostics. TRP2 antibody plays a crucial role in detecting the presence of TRP2, which is often associated with certain types of cancers. This antibody has been extensively studied and has shown promising results in identifying and monitoring the progression of diseases. Whether you are working in life sciences or conducting cutting-edge research, TRP2 antibody is an invaluable tool for detecting and analyzing this important biomarker. With its high specificity and sensitivity, this polyclonal antibody can provide accurate and reliable results for your experiments. Trust TRP2 antibody to deliver precise and consistent data that will contribute to advancing medical knowledge and improving patient care.</p>

<p>CHK1 antibody was raised in Mouse using a purified recombinant fragment of CHK1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal RALBP1 antibody</p>

<p>Rabbit polyclonal CKX2 antibody</p>

<p>The ARNT antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets the aryl hydrocarbon receptor nuclear translocator (ARNT) protein. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and the response to environmental toxins. The ARNT antibody has been extensively studied and has shown promising results in research related to epidermal growth factor signaling, alpha-synuclein aggregation, dopamine metabolism, and thrombocytopenia. Additionally, it has been used as a tool for studying nuclear localization and function of ARNT. This highly specific monoclonal antibody is cytotoxic and can be used for various applications in immunohistochemistry, immunofluorescence, western blotting, and flow cytometry. It is an essential tool for researchers working in the field of molecular biology and offers great potential for further discoveries in this area.</p>

<p>Rabbit Polyclonal Myc antibody (Ser62)</p>

<p>WNT2B antibody was raised using the N terminal of WNT2B corresponding to a region with amino acids LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT</p>

<p>The EV71 antibody is an anti-HER2 antibody that specifically targets the HER2 protein, also known as human epidermal growth factor receptor 2. It is commonly used in the field of Life Sciences for various research and diagnostic purposes. The EV71 antibody has a high affinity for HER2 and can effectively bind to this receptor, blocking its interaction with growth factors and inhibiting downstream signaling pathways. This antibody has been extensively studied and proven to be effective in inhibiting the proliferation of cancer cells that overexpress HER2, making it a valuable tool in cancer research. Additionally, the EV71 antibody has shown cytotoxic effects on cancer cells by inducing apoptosis, making it a potential candidate for targeted therapy. With its specificity and potency, the EV71 antibody is a valuable tool for researchers studying HER2-related diseases and developing novel therapeutic strategies.</p>

<p>The Human IgA Antibody is a powerful tool in Life Sciences research. This antibody specifically targets and binds to the epidermal growth factor, making it an essential component in various cytotoxic assays. It has also been linked to thrombocytopenia, making it a valuable resource for studying blood disorders.</p>

<p>The PDK1 antibody is a monoclonal antibody that targets the growth factor receptor PDK1. It specifically binds to the antigen expressed on the surface of cells and inhibits the activation of PDK1, which plays a crucial role in cell growth and survival. This antibody has been shown to block the binding of vitronectin, glucagon, galactose, and chemokines to PDK1, thereby preventing downstream signaling pathways associated with cell proliferation. The PDK1 antibody is a potent family kinase inhibitor that can be used in research studies to investigate the role of PDK1 in various cellular processes. It has also shown promising results in preclinical studies as a potential therapeutic target for diseases such as cancer. Additionally, this antibody can be used in combination with other targeted therapies, such as cetuximab or epidermal growth factor receptor (EGFR) inhibitors, to enhance their efficacy. The PDK1 antibody is available as a high-quality monoclonal antibody</p>

<p>PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK</p>

<p>Rat monoclonal CD38 antibody (biotin)</p>

<p>FRK antibody was raised in Rabbit using Human FRK as the immunogen</p>

<p>The CD18 antibody is a monoclonal antibody that targets endothelial growth and erythropoietin. It specifically binds to low density lipoprotein (LDL) receptors on the surface of cells, inhibiting their uptake of LDL cholesterol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Purified Polyclonal CK1 gamma 2 antibody</p>

<p>GNL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR</p>

<p>HIV1 antibody (HTLV3) (HRP) was raised in goat using human isolate as the immunogen.</p>

<p>The EEN antibody is a glycoprotein that has cytotoxic properties and is known for its anti-glial fibrillary acidic protein (GFAP) activity. It belongs to the family of antibodies that target specific proteins involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to adipocytes, endothelial growth factors, and fatty acid metabolism. The EEN antibody is widely used in scientific studies and experiments to investigate the role of GFAP and its potential therapeutic applications. It is available as polyclonal antibodies, ensuring high specificity and sensitivity for accurate detection and analysis.</p>

<p>RGS16 antibody is a monoclonal antibody that specifically targets and inhibits the activity of RGS16 protein. RGS16 is involved in various cellular processes, including growth factor signaling, apoptosis, and immune response. By binding to RGS16, this antibody prevents its activation and cytotoxic effects. It also interferes with the formation of RGS16 dimers, which are necessary for its function. This monoclonal antibody has been shown to be effective in inhibiting the growth of Mycoplasma genitalium, a bacterium associated with various reproductive disorders. Additionally, it has potential therapeutic applications in autoimmune diseases where autoantibodies target RGS16 or its interacting proteins. The use of this antibody may provide insights into the role of RGS16 in different cellular pathways and contribute to the development of novel treatments.</p>

<p>BMP2 antibody was raised in Rabbit using Human BMP2 as the immunogen</p>

<p>MMP2 antibody was raised in Rabbit using Human MMP2 as the immunogen</p>

<p>TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA</p>

<p>Fgf3 antibody was raised in rabbit using the C terminal of Fgf3 as the immunogen</p>

<p>The PACSIN1 antibody is a highly specific monoclonal antibody that has been extensively tested and validated for use in various life science research applications. This antibody is particularly useful for studying the role of PACSIN1, a protein involved in diverse cellular processes such as endocytosis, vesicle trafficking, and cytoskeletal dynamics.</p>

<p>MAP2K7 antibody was raised using the middle region of MAP2K7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL</p>

<p>ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC</p>

<p>Rabbit polyclonal OGFOD2 antibody</p>

<p>The EPHA3 antibody is a highly specialized monoclonal antibody that plays a crucial role in various bioassays and research applications within the Life Sciences field. This antibody is specifically designed to target and bind to the EPHA3 receptor, which is a member of the Eph receptor family involved in cell signaling.</p>

<p>Rabbit polyclonal GSK3 alpha antibody</p>

<p>The SNAI1 antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the SNAI1 protein, which plays a crucial role in various cellular processes such as epithelial-mesenchymal transition (EMT) and cancer progression. This antibody has been extensively validated for its high specificity and sensitivity in detecting SNAI1 expression.</p>

<p>The FGFR2 antibody is a monoclonal antibody that specifically targets the Flavobacterium heparinum growth factor receptor 2 (FGFR2). This antibody has been extensively studied in the field of life sciences and has shown promising results in various experiments. It has been found to inhibit the binding of transferrin to FGFR2, thereby disrupting the growth factor signaling pathway. The FGFR2 antibody has also been shown to block the activation of GM-CSF (colony-stimulating factor) and TGF-β1, which are important factors for cell proliferation and differentiation. Additionally, this antibody exhibits anti-MERTK activity, further highlighting its potential therapeutic applications. Researchers have successfully used the FGFR2 antibody in immunofluorescence studies by conjugating it with phalloidin, an actin-specific probe. This allows for visualization and analysis of cellular structures under a microscope. With its specific targeting capabilities and diverse range of applications, the FGFR2</p>

<p>CYP51A1 antibody was raised in Rabbit using Human CYP51A1 as the immunogen</p>

<p>Rabbit polyclonal IGLL1 antibody</p>

<p>Rabbit polyclonal DGKI antibody</p>

<p>The BMP2 antibody is a highly specific diagnostic reagent that belongs to the class of antibodies. It is used to detect and analyze protein complexes involved in various biological processes, including the TGF-beta signaling pathway. This antibody has been shown to have specific reactivity towards inflammasome proteins, making it a valuable tool for studying the immune response. The BMP2 antibody can be used in various assays, such as fluorescent assays or polymerase chain reactions, to detect and quantify the presence of target proteins. In addition to its diagnostic applications, this monoclonal antibody has also been found to have immunomodulatory effects, potentially affecting cell function and promoting opsonophagocytic activity. With its wide range of applications in life sciences research, the BMP2 antibody is an essential tool for scientists studying protein interactions and cellular processes.</p>

<p>Purified Polyclonal CD178 antibody</p>

<p>Rb1 Monoclonal Antibody (HRP)</p>

<p>GIPC1 antibody was raised in Rabbit using Human GIPC1 as the immunogen</p>

<p>The GRP78 antibody is a specialized antibody that plays a crucial role in various biological processes. It contains unique sugar moieties, including EGF-like domains, which contribute to its functionality. This antibody has been found to possess hyaluronidase activity, making it capable of breaking down hyaluronic acid in the extracellular matrix. Additionally, the GRP78 antibody has neutralizing properties against specific targets, making it an essential tool in research and diagnostics.</p>

<p>Rabbit Polyclonal CD122 antibody (Tyr364)</p>

<p>CHRNB2 antibody was raised in rabbit using the N terminal of CHRNB2 as the immunogen</p>

<p>PREP antibody was raised using the middle region of PREP corresponding to a region with amino acids LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM</p>

<p>TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD</p>

<p>HNRPUL1 antibody was raised using the C terminal of HNRPUL1 corresponding to a region with amino acids LDADDEPGRPGHINEEAELQPATLQPGRLQPGLHSPTASTSTTTCLQLWE</p>

<p>The Cytokeratin 18 antibody is a diagnostic agent used in the field of Life Sciences. It is an inhibitory compound that specifically targets mesenchymal stem cells. This monoclonal antibody binds to cytokeratin 18, a protein found in the cytoplasm of epithelial cells. By targeting this protein, the antibody can be used to identify and isolate mesenchymal stem cells from other cell types. Additionally, the Cytokeratin 18 antibody can be used to detect cleavage products of cytokeratin 18 in blood plasma, which may serve as biomarkers for certain diseases or conditions. Its high specificity and affinity make it a valuable tool for researchers and clinicians working in various fields such as cancer research and regenerative medicine.</p>

<p>PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG</p>

<p>The BAD antibody is a cholinergic plasticizer used in Life Sciences. It is an antibody that specifically binds to the antigen binding domain of BAD, a protein involved in regulating cell survival and apoptosis. This antibody has been shown to inhibit the formation of syncytia, which are multinucleated cells formed by the fusion of multiple cells. Additionally, it has been demonstrated to have an effect on nuclear localization and tyrosine phosphorylation of BAD. The BAD antibody is commonly used in research and can be paired with other antibodies such as interleukin-6 or dopamine antibodies for various applications in biomolecular studies. Whether you're conducting experiments or studying cellular processes, this high-quality monoclonal antibody is an essential tool for your research needs.</p>

<p>Rabbit polyclonal SDHC antibody</p>

<p>CNTFR antibody was raised in Rabbit using Human CNTFR as the immunogen</p>

<p>Mouse monoclonal p19INK4d antibody</p>

<p>The MMP3 antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of matrix metalloproteinase 3 (MMP3). This antibody is designed to specifically bind to the histidine region of MMP3, inhibiting its function and preventing it from degrading extracellular matrix components such as collagen. By blocking the activity of MMP3, this antibody helps maintain the integrity of tissues and prevents excessive tissue remodeling.</p>

<p>CD166 antibody was raised in Mouse using a purified recombinant fragment of CD166(aa405-524) expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal Giardia intestinalis antibody</p>

<p>The TPP1 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the histidine residue of the TPP1 protein and has been shown to have neutralizing effects on its activity. The antibody binds to the polymorphic region of TPP1, preventing it from interacting with other proteins and affecting various cellular processes. This colloidal antibody can be used for quantitation purposes in experiments involving antigen-antibody reactions. Additionally, monoclonal antibodies derived from the TPP1 antibody have been developed for specific applications, such as detecting TPP1 levels in human serum or studying its role in adipose tissue.</p>

<p>Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV</p>

<p>Rabbit polyclonal PTPN5 antibody</p>

<p>Factor XIII Subunit A antibody was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal Peptide YY antibody (biotin)</p>

<p>Rabbit polyclonal PPP1R2 antibody</p>

<p>IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been extensively studied using advanced techniques such as patch-clamp technique on human erythrocytes. The metabolization process involves various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their cell growth in culture.</p>

<p>STUB1 antibody was raised using the C terminal of STUB1 corresponding to a region with amino acids VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF</p>

<p>Rabbit polyclonal ACOT4 antibody</p>

<p>The ACTH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to adrenocorticotropic hormone (ACTH), a peptide hormone involved in the regulation of steroid synthesis in the adrenal glands. This antibody has been extensively studied and validated for its high specificity and affinity towards ACTH.</p>

<p>Rabbit polyclonal Cytokeratin 8 antibody (Ser431)</p>

<p>Rabbit polyclonal IGF1R antibody (Tyr1165/Tyr1166)</p>

<p>The IL13RA2 antibody is a powerful tool used in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets the interleukin-13 receptor alpha 2 (IL13RA2). This antibody has shown high affinity and specificity for IL13RA2, making it an ideal choice for various research applications.</p>

<p>The Ataxin 2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to annexin, a protein involved in various cellular processes. This buffered monoclonal antibody has been extensively tested and validated for its efficacy and specificity.</p>

<p>Purified Rabbit polyclonal OR51A4 antibody</p>

<p>The SREBP1 antibody is a powerful tool used in life sciences research to study various aspects of cellular processes. It specifically targets the Sterol Regulatory Element-Binding Protein 1 (SREBP1), which plays a crucial role in lipid metabolism and the regulation of fatty acid synthesis.</p>

<p>WDR35 antibody was raised using the N terminal of WDR35 corresponding to a region with amino acids SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS</p>

<p>Rat monoclonal CD90.2 antibody (PE)</p>

<p>Rabbit polyclonal Glycogen Synthase antibody (Ser645)</p>

<p>GTDC1 antibody was raised in Rabbit using Human GTDC1 as the immunogen</p>

<p>Rabbit polyclonal RPL27 antibody (biotin)</p>

<p>Mouse monoclonal ALOX15 antibody</p>

<p>Purified Polyclonal NMDAR2C antibody</p>