Anticuerpos primarios

<p>Purified Polyclonal PDE4B/C/D antibody</p>

<p>FOXA1 antibody is a cytotoxic and antiviral monoclonal antibody that is used in the field of Life Sciences. This antibody has neutralizing properties and can target specific interleukins in the body. It has been shown to be effective in reducing the formation of amyloid plaques, which are associated with certain neurodegenerative diseases. The FOXA1 antibody can be used in various research applications, such as immunoassays and Western blotting. Its high specificity and affinity make it a valuable tool for studying protein-protein interactions and cellular signaling pathways. With its potential therapeutic applications, this antibody holds promise as a future medicament for treating various diseases.</p>

<p>The TKT antibody is a biomaterial that specifically targets and binds to certain proteins in the body. It has been shown to interact with collagen, p53 protein, alpha-fetoprotein, and other activated growth factors such as epidermal growth factor. This monoclonal antibody has a high affinity for its target proteins, allowing for precise and effective targeting in various applications.</p>

<p>Affinity purified Rabbit polyclonal Ataxin 3 antibody</p>

<p>The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.</p>

<p>The Chk1 antibody is a powerful tool in the field of Life Sciences. It is an interferon-gamma (IFN-γ) antibody that exhibits cytotoxic effects on targeted cells. This polyclonal antibody specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. The Chk1 antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA assays.</p>

<p>Mouse monoclonal KHK antibody</p>

<p>ARF1 antibody was raised in Rabbit using Human ARF1 as the immunogen</p>

<p>CNR1 antibody was raised in Rabbit using Human CNR1 as the immunogen</p>

<p>Rabbit polyclonal WDR77 antibody</p>

<p>The CD90 antibody is a highly specific polyclonal antibody that targets the CD90 antigen, also known as Thy-1. It is commonly used in research and diagnostic applications to detect and analyze human proteins. This antibody has been extensively validated for its high affinity and specificity in various assays, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>Antithrombin III antibody (HRP) was raised in sheep using human antithrombin purified from plasma as the immunogen.</p>

<p>The SOS1 antibody is a highly specialized antibody that targets the SOS1 protein, an oncogene homolog involved in cell signaling pathways. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.</p>

<p>SLC19A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP</p>

<p>GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR</p>

<p>Purified Polyclonal DMPK antibody</p>

<p>The Glycogen Synthase antibody is a powerful tool in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets glycogen synthase, an enzyme involved in glycogen synthesis. This antibody has been extensively studied and validated for its high specificity and sensitivity.</p>

<p>Affinity purified Rabbit polyclonal Leucine zipper protein 1 antibody</p>

<p>The GPR116 antibody is a highly specialized monoclonal antibody that targets the G-protein coupled receptor 116. This antibody has been extensively used in various assays and research studies in the field of Life Sciences. It specifically inhibits the activity of GPR116, which is a family kinase inhibitor involved in regulating dopamine signaling pathways.</p>

<p>Mouse monoclonal Exendin 4 antibody (Biotin)</p>

<p>Rabbit polyclonal CSRP1 antibody (FITC)</p>

<p>CD37 antibody was raised in Mouse using a purified recombinant fragment of CD37 expressed in E. coli as the immunogen.</p>

<p>Rat monoclonal CD244.2 antibody (PE)</p>

<p>Rabbit polyclonal HLAB antibody</p>

<p>RHOJ antibody was raised using the middle region of RHOJ corresponding to a region with amino acids LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK</p>

<p>Rabbit polyclonal Kinase E28 antibody</p>

<p>The BACH1 antibody is a polyclonal antibody that targets the nuclear protein BACH1. This antibody is widely used in life sciences research to study the role of BACH1 in various cellular processes, including the regulation of neurotrophic factors and TNF-α. It has been shown to have inhibitory properties, immobilizing BACH1 and preventing its interaction with other proteins. Additionally, this antibody has natriuretic and neutralizing effects on certain antibodies, such as anti-CD33 antibody and TGF-β1. Researchers rely on the specificity and effectiveness of the BACH1 antibody to gain insights into the molecular mechanisms underlying various biological processes.</p>

<p>CEP55 antibody was raised using the middle region of CEP55 corresponding to a region with amino acids TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL</p>

<p>TAF9L antibody was raised in mouse using recombinant Human Taf9B Rna Polymerase Ii, Tata Box Binding Protein, (Tbp)-Associated Factor, 31Kda (Taf9B)</p>

<p>BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids QENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQS</p>

<p>Rabbit polyclonal IBP7 antibody</p>

<p>DDX21 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEET</p>

<p>Rabbit polyclonal KLF10/11 antibody</p>

<p>The IL13 antibody is a highly specialized molecular docking and immobilization agent. It is designed to target and bind to the IL13 hormone peptide, effectively neutralizing its effects. This monoclonal antibody has been extensively tested and proven to be effective in various research studies within the Life Sciences field.</p>

<p>Mouse monoclonal BIRC2 antibody</p>

<p>Purified Polyclonal Cerebellin 4 antibody</p>

<p>Rabbit polyclonal ATP5D antibody</p>

<p>ARHGEF16 antibody was raised in Rabbit using Human ARHGEF16 as the immunogen</p>

<p>The RAE1 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to the racemase enzyme, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in immobilizing the racemase enzyme, thereby inhibiting its activity.</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>Rabbit polyclonal ARFGAP3 antibody</p>

<p>The S6K1 antibody is a highly specific monoclonal antibody that can be used in various applications within the Life Sciences field. This antibody specifically targets and binds to the S6K1 protein, which plays a crucial role in cell growth, proliferation, and survival.</p>

<p>The VASP antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that targets the vasodilator-stimulated phosphoprotein (VASP), which plays a crucial role in cell signaling and cytoskeleton organization. This antibody can be used for various applications, including research on epidermal growth factor signaling pathways, cytotoxicity assays, and detection of VASP expression in different tissues and cell types.</p>

<p>The RNF125 antibody is a monoclonal antibody that specifically targets the TRPV4 protein. TRPV4 is a member of the transient receptor potential (TRP) family and plays a crucial role in various physiological processes. This antibody is designed to neutralize the activity of TRPV4, making it an essential tool for researchers studying TRPV4-related functions.</p>

<p>RANTES antibody was raised in mouse using highly pure human RANTES as the immunogen.</p>

<p>The SCAR antibody is a highly specific autoantibody that functions as an inhibitor of tyrosine. It is designed to target and block the activity of cortisol, a hormone involved in various physiological processes. By binding to cortisol, the SCAR antibody effectively reduces its concentration in the body. This low density cortisol has been shown to have therapeutic potential in assays and has been used as a medicament in the field of Life Sciences. Additionally, the SCAR antibody has demonstrated its ability to interact with other proteins such as vitronectin and androgen receptors. With its activated state, this antibody offers promising applications in research and clinical settings. For those seeking targeted therapies or investigating novel treatment options, the SCAR antibody provides a valuable tool for studying cortisol-related pathways and developing innovative approaches in healthcare.</p>

<p>The mGLUR5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting the androgen receptor and exerting cytotoxic effects on specific cells. This antibody also has the ability to neutralize certain growth factors, interferons, hepatocyte growth factors, and chemokines. Additionally, it exhibits antiviral properties by targeting glycoproteins involved in viral replication. The mGLUR5 antibody is a versatile tool that can be utilized in various research applications, including multidrug resistance studies and electrode-based assays. Its high specificity and potency make it an invaluable asset for scientists working in diverse fields of study.</p>

<p>KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS</p>

<p>AKR1CL2 antibody was raised in Rabbit using Human AKR1CL2 as the immunogen</p>

<p>Rabbit polyclonal RABL3 antibody</p>

<p>CD3e antibody (Azide free) was raised in rat using CD3e as the immunogen.</p>

<p>NDUFS1 antibody was raised in Rabbit using Human NDUFS1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Centaurin alpha 1 antibody</p>

<p>Rabbit polyclonal TAOK2 antibody</p>

<p>PSA antibody was raised in mouse using highly pure human PSA as the immunogen.</p>

<p>Rabbit polyclonal GDF15 antibody (HRP)</p>

<p>KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN</p>

<p>RG9MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE</p>

<p>The Paxillin antibody is a biomolecule that plays a crucial role in various cellular processes. It acts as a substrate for protein kinases and is involved in the regulation of cell adhesion and migration. This antibody can be used in research studies to investigate the function of paxillin and its interactions with other proteins.</p>

<p>XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH</p>

<p>Rabbit polyclonal YEATS4 antibody</p>

<p>The ASK1 antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the adeno-associated virus (AAV), preventing its replication and spread. It has been extensively tested on various cell types, including mesenchymal stem cells, showing excellent results in inhibiting viral infection. Additionally, this antibody has demonstrated its potential as an antiviral therapy by effectively blocking the entry of influenza hemagglutinin into human serum.</p>

<p>DLX1 antibody was raised in Rabbit using Human DLX1 as the immunogen</p>

<p>TMEM106C antibody was raised using the middle region of TMEM106C corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG</p>

<p>EIF4ENIF1 antibody was raised using the N terminal of EIF4ENIF1 corresponding to a region with amino acids DSDGLRLLGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDK</p>

<p>Rabbit polyclonal HDAC2 antibody (Ser394)</p>

<p>MTHFD2 antibody was raised in Rabbit using Human MTHFD2 as the immunogen</p>

<p>Rabbit polyclonal DNAJC5 antibody</p>

<p>GRIN2B antibody was raised in Rabbit using Human GRIN2B as the immunogen</p>

<p>Goat anti-syrian Hamster IgG (H + L) (rhodamine) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal LASS4 antibody</p>

<p>The Apolipoprotein C2 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and inhibits the function of apolipoprotein C2, a protein involved in lipid metabolism. By blocking the activity of apolipoprotein C2, this antibody can be used to study its role in various biological processes.</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Rabbit polyclonal Musashi 2 antibody</p>

<p>LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST</p>

<p>hCG antibody was raised in mouse using the beta subunit of hCG as the immunogen.</p>

<p>PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP</p>

<p>Rabbit polyclonal ACOT12 antibody</p>

<p>TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN</p>

<p>Rabbit polyclonal PSMD11 antibody</p>

<p>Mouse monoclonal CNOT4 antibody</p>

<p>Rabbit polyclonal PIP5K antibody</p>

<p>Rabbit polyclonal RAD23B antibody</p>

<p>Purified Rabbit polyclonal OR10H2 antibody</p>

<p>LRRC28 antibody was raised using the N terminal of LRRC28 corresponding to a region with amino acids KDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIG</p>

<p>The RB antibody is an antibody-drug that specifically targets the tyrosine kinase receptor known as RB. This receptor plays a crucial role in regulating cell growth and division. By binding to the tyrosine residues on the RB receptor, this antibody inhibits its activity, leading to a decrease in cell proliferation.</p>

<p>Rabbit polyclonal TMEM108 antibody</p>

<p>Guinea pig polyclonal Prealbumin antibody (biotin)</p>

<p>Affinity purified Rabbit polyclonal C9orf78 antibody</p>

<p>Rabbit polyclonal UQCRFS1 antibody</p>

<p>Rabbit polyclonal ROBO3 antibody</p>

<p>The 5HT2A antibody is a medicine that belongs to the class of polyclonal antibodies. It targets the dopamine receptor subtype 2A and has been shown to be effective in human hepatocytes. This antibody inhibits the activity of calcium/calmodulin-dependent protein kinase, which plays a key role in cellular signaling pathways. Additionally, it has been found to inhibit the growth of dianhydrogalactitol-induced tumors. The 5HT2A antibody is widely used in life sciences research and is available as both monoclonal and polyclonal antibodies produced from hybridoma cell lines. It has potential applications in various fields, including the treatment of non-alcoholic steatohepatitis and as a protein kinase or cyclin-dependent kinase inhibitor.</p>

<p>The Alpha synuclein antibody is a highly specific monoclonal antibody that targets alpha-synuclein, a protein involved in the pathogenesis of neurodegenerative disorders such as Parkinson's disease. This antibody recognizes the carbonyl group and amino group of alpha-synuclein, allowing for accurate detection and quantification. It has been extensively validated in various research applications, including immunohistochemistry, western blotting, and ELISA. The Alpha synuclein antibody is an essential tool for scientists working in the field of Life Sciences who are studying the role of alpha-synuclein in neurodegeneration and seeking to develop new therapeutic strategies. With its high specificity and sensitivity, this antibody enables precise analysis of alpha-synuclein expression and localization in cellular and tissue samples. Choose the Alpha synuclein antibody for reliable results in your research endeavors.</p>

<p>TEF antibody is a polyclonal antibody that acts as an anticoagulant by neutralizing the activity of a specific growth factor. It is commonly used in life sciences research to study the effects of this growth factor on various biological processes. TEF antibody can be produced as a monoclonal antibody or generated through the lyophilization method, which ensures stability and long shelf life. It is widely used for quantitation purposes in experiments involving electrophoresis and other analytical techniques. Additionally, TEF antibody has been found to have potential therapeutic applications in autoimmune disorders, where it can target autoantibodies and interfere with their harmful effects. Its unique properties make TEF antibody a valuable tool in biomedical research and clinical settings.</p>

<p>STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG</p>

<p>Rabbit polyclonal BAD antibody (Ser155)</p>

<p>CASP3 antibody was raised in rabbit using the C terminal of CASP3 as the immunogen</p>

<p>FABP1 antibody was raised in Rabbit using Human FABP1 as the immunogen</p>

<p>SULT6B1 antibody was raised using the C terminal of SULT6B1 corresponding to a region with amino acids FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL</p>

<p>Rabbit polyclonal ZNRF2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth, preventing transcription and replication.</p>

<p>Mouse monoclonal RPN1 antibody</p>

<p>The IL3 antibody is a monoclonal antibody that has cytotoxic properties and is used in the field of Life Sciences. It specifically targets the chemokine angptl3 and acts as a neutralizing agent. This monoclonal antibody inhibits the growth factor activity of angptl3, which is a glycoprotein involved in adipose tissue regulation. By blocking the function of angptl3, this antibody can potentially be used as a therapeutic tool for various conditions related to adipose tissue dysfunction. The IL3 antibody is widely recognized in the scientific community for its high specificity and potency, making it an essential tool for researchers studying the role of angptl3 in different physiological processes. In addition to its use in research, this antibody also has potential applications in clinical settings for targeted therapy against diseases associated with dysregulated adipose tissue.</p>

<p>The FER antibody is a cytotoxic protein that belongs to the category of Life Sciences. It is known for its neutralizing properties and can be used in conjunction with other drugs such as trastuzumab and sorafenib. This antibody targets specific growth factors, including epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta), inhibiting their activity. The FER antibody is available in both polyclonal and monoclonal forms, providing flexibility in research applications. It has also shown potential as an anti-acth antibody, making it a promising option for various therapeutic purposes. When used in combination with doxorubicin, the FER antibody has demonstrated enhanced efficacy against certain types of cancer cells.</p>

<p>Armenian Hamster monoclonal gamma delta TCR antibody (PE)</p>

<p>The CD36 antibody is a monoclonal antibody that is widely used in the field of life sciences. It specifically targets the CD36 protein, which plays a crucial role in various cellular processes such as collagen binding and fatty acid uptake. This antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD36.</p>

<p>Rabbit polyclonal MDR1 antibody (HRP)</p>

<p>Mouse Anti Mullerian Hormone antibody</p>

<p>Mouse monoclonal CNDP2 antibody</p>

<p>Mouse monoclonal DDX39B antibody</p>

<p>Fibrinopeptide A antibody was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.</p>

<p>Purified Rabbit polyclonal ZNF792 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. Specifically designed to target tuberculosis infection, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has shown its effectiveness through various techniques such as patch-clamp technique and transcription-quantitative polymerase chain. Furthermore, it undergoes metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains and inhibit cell growth, this compound is a powerful weapon against tuberculosis.</p>

<p>Mouse monoclonal C2orf56 antibody</p>

<p>Tat antibody was raised in rabbit using the C terminal of Tat as the immunogen</p>

<p>Rabbit Polyclonal MBTPS1 antibody</p>

<p>Rabbit polyclonal STAG3 antibody</p>

<p>Affinity purified Rabbit polyclonal RARRES3 antibody</p>

<p>Rabbit polyclonal Collagen V alpha 1 antibody</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>The GAB1 antibody is a monoclonal antibody that specifically targets the activated form of GAB1, a human protein involved in various cellular processes. This antibody has been extensively studied in the field of life sciences and has shown promising results. It has been found to inhibit the activity of GAB1 and its downstream signaling pathways, including those involved in alpha-fetoprotein production and colony-stimulating factor release. Additionally, this antibody has demonstrated minimal toxic effects on cells and tissues, making it a safe and effective tool for research purposes. With its high specificity and affinity for GAB1, the GAB1 antibody is an invaluable resource for scientists studying cellular signaling pathways and their role in disease development.</p>

<p>TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG</p>

<p>Purified Polyclonal PFKFB2 antibody</p>

<p>GALNT6 antibody was raised using the N terminal of GALNT6 corresponding to a region with amino acids MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP</p>

<p>TNF alpha antibody was raised in Mouse using recombinant human TNF alpha as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal Activin A Receptor type IIA antibody</p>

<p>Mouse monoclonal TNF alpha antibody (biotin)</p>

<p>IGF BP5 antibody was raised in rabbit using highly pure recombinant human IGF-BP5 as the immunogen.</p>

<p>Factor B antibody was raised against Human Factor B (C3 Proactivator).</p>

<p>C3orf20 antibody was raised in Rabbit using Human C3orf20 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal ARF1 antibody</p>

<p>TST antibody is a polypeptide expression of autoantibodies that specifically target the protein kinase. This antibody is widely used in Life Sciences research to study the role of protein kinases in various cellular processes. It has been shown to be effective in detecting and quantifying protein kinase activity in microvessel endothelial cells. TST antibody can also be used as a recombinant antigen for biochemical assays and interferon detection. Additionally, it has been utilized to investigate collagen-related diseases and evaluate the effects of inhibitors on protein kinase activity. With its versatility and specificity, TST antibody is an essential tool for researchers studying a wide range of biological processes, including non-alcoholic steatohepatitis and food extract analysis.</p>

<p>Rabbit polyclonal SFRS9 antibody</p>

<p>Rabbit polyclonal CtBP1 antibody (Ser422)</p>

<p>HPS5 antibody was raised in Rabbit using Human HPS5 as the immunogen</p>

<p>OLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ</p>

<p>Rabbit polyclonal Alpha synuclein antibody (biotin)</p>

<p>The GFAP antibody is a monoclonal antibody widely used in the field of Life Sciences. It specifically targets and neutralizes the glial fibrillary acidic protein (GFAP), which is an important antigen involved in various cellular processes. This antibody has been extensively tested and proven to be highly effective in assays related to interferon, transferrin, anti-hbs, low-density lipoprotein, fatty acid metabolism, and other related research areas. With its high specificity and affinity, the GFAP antibody is a valuable tool for scientists and researchers studying the role of GFAP in different biological systems. It comes with all necessary excipients for optimal performance and is available in various formats to suit different experimental needs. Trust the GFAP antibody to provide reliable and accurate results for your research endeavors.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its effectiveness has been extensively tested using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The Fractalkine antibody is a powerful anticoagulant that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing the virus surface antigen, preventing its ability to cause harm. This antibody has been extensively studied and characterized using mass spectrometric methods, ensuring its high quality and effectiveness. In addition to its anticoagulant properties, the Fractalkine antibody also acts as a chemokine, attracting immune cells to the site of infection and promoting an effective immune response. It has been shown to activate 3-kinase signaling pathways and enhance interferon production. The Fractalkine antibody is available in both polyclonal and monoclonal forms, providing options for different research needs. With its exceptional performance and reliability, this antibody is a valuable tool in Life Sciences research.</p>

<p>KLHL2 antibody was raised in Rabbit using Human KLHL2 as the immunogen</p>

<p>Rabbit polyclonal HLX1 antibody</p>

<p>RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF</p>

<p>The ERH antibody is a monoclonal antibody that targets the ERH protein. This protein is involved in various cellular processes, including insulin signaling and glutamate metabolism. The ERH antibody specifically recognizes the amino group of the ERH protein and can be used in various applications, such as Western blotting and immunohistochemistry.</p>

<p>Purified Polyclonal PITP beta antibody</p>

<p>Rabbit polyclonal SAV1 antibody</p>

<p>Rabbit Polyclonal Myc antibody (Thr58)</p>

<p>The ActA antibody is a monoclonal antibody used as a diagnostic reagent in the field of Life Sciences. It specifically binds to ActA, a protein found in human serum that is associated with choroidal neovascularization. This antibody has high affinity and specificity for ActA and can be used to detect its presence in samples. Additionally, the ActA antibody has been shown to have serum albumin binding properties, making it useful for various applications in biomolecule research. It does not exhibit any toxic effects or induce oxidative damage, ensuring its safety for use in laboratory settings. With its exceptional performance and reliability, the ActA antibody is an essential tool for researchers working in the field of Life Sciences.</p>

<p>CENPJ antibody was raised in Rabbit using Human CENPJ as the immunogen</p>

<p>The AKR1C3 antibody is a reactive antibody used in Life Sciences research. It can be used as both a polyclonal and monoclonal antibody. This antibody is commonly used to detect autoantibodies in human serum samples. It specifically targets AKR1C3, an enzyme that plays a role in hormone metabolism and has been implicated in various diseases, including cancer.</p>

<p>Rabbit polyclonal RND2 antibody</p>

<p>MTIF3 antibody was raised in Rabbit using Human MTIF3 as the immunogen</p>

<p>The SOCS2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets fatty acid, e-cadherin, and insulin antibodies. This antibody is widely used in research related to adipose tissue and adipocytes. It has been shown to have an impact on glycosylation and e-cadherin expression, which are important factors in various biological processes.</p>

<p>MPG antibody was raised in Rabbit using Human MPG as the immunogen</p>

<p>GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV</p>

<p>Fgf3 antibody was raised in rabbit using the C terminal of Fgf3 as the immunogen</p>

<p>IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL</p>

<p>LYZL6 antibody was raised in Rabbit using Human LYZL6 as the immunogen</p>

<p>Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP</p>

<p>AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF</p>

<p>Rabbit polyclonal PSG4 antibody</p>

<p>Na, K ATPase antibody was raised in mouse using purified rat kidney Na, K ATPase as the immunogen.</p>

<p>BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK</p>

<p>BDH1 antibody was raised in Mouse using a purified recombinant fragment of human BDH1 expressed in E. coli as the immunogen.</p>

<p>GTPBP3 antibody was raised in Rabbit using Human GTPBP3 as the immunogen</p>

<p>Rabbit polyclonal Mt13 antibody</p>

<p>FIS1 antibody was raised in Rabbit using Human FIS1 as the immunogen</p>

<p>The CYP2S1 antibody is a highly specialized insulin antibody that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This monoclonal antibody has been extensively tested and proven effective in immunoassays, making it an invaluable tool for researchers studying TNF-α-related diseases. Additionally, the CYP2S1 antibody can be used in combination with other monoclonal antibodies to detect and quantify specific proteins, such as rubisco or insulin, in various biological samples. With its high specificity and sensitivity, this molecule drug holds great promise for advancing our understanding of complex molecular interactions and developing targeted therapies against TNF-α-mediated disorders.</p>

<p>BRCA1 antibody was raised in Rabbit using Human BRCA1 as the immunogen</p>

<p>Rabbit polyclonal Nibrin antibody</p>

<p>Affinity purified Rabbit polyclonal GMF beta antibody</p>

<p>The TRIB3 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It specifically targets and binds to the growth factor TRIB3, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be an effective tool for research purposes.</p>

<p>SLC16A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN</p>

<p>Mouse monoclonal TAL1 antibody</p>

<p>Mouse monoclonal TUBB4 antibody</p>

<p>KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL</p>

<p>ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN</p>

<p>The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.</p>

<p>Rabbit polyclonal PEBP1 antibody</p>

<p>MAD2L1BP antibody was raised in Rabbit using Human MAD2L1BP as the immunogen</p>

<p>The PDCD5 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is designed to target and bind to the protein known as Programmed Cell Death 5 (PDCD5). This antibody has been extensively studied for its potential therapeutic applications due to its ability to inhibit cell growth and induce apoptosis (programmed cell death).</p>

<p>AMY2B antibody was raised in rabbit using the C terminal of AMY2B as the immunogen</p>

<p>CD22 antibody was raised in rat using CD22 as the immunogen.</p>

<p>LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR</p>

<p>Purified Polyclonal THRA antibody</p>

<p>Rabbit polyclonal cJun antibody</p>