Anticuerpos primarios

<p>STARD4 antibody was raised in rabbit using the middle region of STARD4 as the immunogen</p>

<p>KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids HMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRN</p>

<p>KCNQ5 antibody was raised using the middle region of KCNQ5 corresponding to a region with amino acids LGKGQITSDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLL</p>

<p>Ubl3 antibody was raised in rabbit using the C terminal of Ubl3 as the immunogen</p>

<p>Coro2b antibody was raised in rabbit using the C terminal of Coro2b as the immunogen</p>

<p>EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS</p>

<p>LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAA</p>

<p>USP38 antibody was raised in rabbit using the middle region of USP38 as the immunogen</p>

<p>VTI1A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL</p>

<p>ZNF117 antibody was raised in rabbit using the N terminal of ZNF117 as the immunogen</p>

<p>gAcrp30 antibody was raised in goat using highly pure recombinant human gAcrp30/adipolean as the immunogen.</p>

<p>LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI</p>

<p>HOXA9 antibody was raised in rabbit using the middle region of HOXA9 as the immunogen</p>

<p>JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ</p>

<p>PRSS21 antibody was raised in rabbit using the N terminal of PRSS21 as the immunogen</p>

<p>CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ</p>

<p>RFC1 antibody was raised in rabbit using the middle region of RFC1 as the immunogen</p>

<p>Ascc1 antibody was raised in rabbit using the C terminal of Ascc1 as the immunogen</p>

<p>NCKAP1L antibody was raised in rabbit using the C terminal of NCKAP1L as the immunogen</p>

<p>PARP6 antibody was raised in rabbit using the N terminal of PARP6 as the immunogen</p>

<p>DIABLO antibody was raised in rabbit using C terminus of the human DIABLO protein as the immunogen.</p>

<p>ZNF566 antibody was raised in rabbit using the middle region of ZNF566 as the immunogen</p>

<p>PSCA antibody was raised in rabbit using the C terminal of PSCA as the immunogen</p>

<p>Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment</p>

<p>Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dengue Virus Type 3 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Human Nectin-4 Monoclonal Antibody</p>

<p>The Androstenedione antibody is a highly specialized antibody that targets and binds to androstenedione, a hormone involved in the production of testosterone and estrogen. This antibody has been extensively studied for its role in various research areas, including hormone regulation, reproductive health, and cancer studies.</p>

<p>Sheep polyclonal Creatinine Acid antibody</p>

<p>Blinatumomab is a bispecific T-cell engager (BiTE), an immunotherapy specifically designed to target and redirect the body's immune system to attack cancer cells. This is possible as Blinatumomab has two single-chain antibody variable fragments. One of these targets CD3+ on T-cells while the other recognizes CD19 on malignant B-cells. As such the body's T-cells become activated and exert cytotoxic activity on the target cell.<br>Blinatumomab has been approved for the treatment of a type of acute lymphoblastic leukemia (ALL) called Philadelphia chromosome-negative B-cell precursor ALL. This medication has demonstrated efficacy in patients with relapsed or refractory ALL, and it has also been used in the minimal residual disease (MRD) setting to help eliminate any remaining cancer cells after initial treatment. <br>One advantage of Blinatumomab is that, CD3 and CD19 are present in both pediatric and adult patients. As such it can be a potential therapeutic for both patient sets.</p>

<p>Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Human PCSK9 Monoclonal Antibody; 98%</p>

<p>Pig RBC antibody was raised in rabbit using porcine erythrocytes as the immunogen.</p>

<p>Monoclonal antibody against EGFR</p>

<p>Please enquire for more information about Dengue Virus Type 2 NS1 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Contains 0.1% Proclin300 as preservative</p>

<p>NCGC00229600: Allosteric inverse TSHR agonist; blocks TSH and antibody TSHR activation; for Graves' disease research.</p>

<p>The Methotrexate antibody is a monoclonal antibody that specifically targets and binds to Methotrexate, a commonly used cytotoxic drug in the field of Life Sciences. This antibody has been extensively tested and validated for its high affinity and specificity towards Methotrexate. It can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The Methotrexate antibody works by binding to Methotrexate molecules and preventing their interaction with their target enzymes involved in DNA synthesis. This inhibits the growth of cancer cells and autoimmune responses mediated by activated T-cells. Additionally, this antibody can also be utilized as a tool for studying the intracellular localization and trafficking of Methotrexate within cells. The unique features of this Methotrexate antibody include its ability to recognize both free Methotrexate molecules as well as Methotrexate conjugated to proteins or other biomolecules. It exhibits minimal cross-reactivity with</p>

<p>CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.</p>

<p>Benzoylecgonine antibody was raised in mouse using benzoyl ecgonine-BSA as the immunogen.</p>

<p>Mucin antibody was raised in mouse using Mucin isolated from ovarian mucinous cysts and colonic mucosa as the immunogen.</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>

<p>Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.</p>

<p>The CYFRA21-1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets fibronectin, a protein involved in cell adhesion and migration. It has cytotoxic properties, making it useful for studying cellular processes and identifying potential therapeutic targets. Additionally, the CYFRA21-1 antibody can be used to detect inhibitory factors or antiphospholipid antibodies in biological samples. It is also effective in detecting insulin antibodies, autoantibodies, and antibodies involved in glycosylation processes. With its high specificity and sensitivity, this monoclonal antibody is an invaluable tool for researchers looking to uncover new insights into various biological pathways and disease mechanisms.</p>

<p>Sheep polyclonal Mescaline antibody</p>

<p>Anti-Trop2</p>

<p>Extracellular signal-regulated kinase 1/2 (ERK1/2) is a mitogen-activated protein kinase (MAPK) family protein and part of the Ras-Raf-MEK-ERK signalling pathway which plays a key role in controlling cell proliferation, differentiation and cell survival. ERK1/2 acts downstream of activated growth factor receptors, RAF protein kinases and mitogen-activated protein kinase kinases 1 and 2 (MEK1/2). MEK1 and MEK2 activate ERK1/2 by phosphorylation and once activated ERK1/2 enters the nucleus and phosphorylates transcription factors to induce changes in gene expression. In addition to this active ERK1/2 also translocates to other organelles including the endoplasmic reticulum, endosomes, golgi and mitochondria where it influences cell physiology. Overall ERK1/2 phosphorylates more than 200 different substrates including other protein kinases, transcription factors, RNA-binding proteins, regulators of mRNA translation and regulators of cell death. ERK1/2 pathway is strongly implicated in cancer where its hyperactivation underpins the growth and maintenance of many tumour types. Data: Western blot analysis of whole cell extract of Mouse embryonic Fibroblasts (MEFs).</p>

<p>Primate-specific Mas-related G protein-coupled receptor-X1 (MRGPR-X1) is highly enriched in dorsal root ganglia (DRG) neurones as well as in connective tissue mast cells (CTMC) and the leukaemia-derived human mast cell line (LAD)-2. MRGPR-X1 activation induces acute pain and therefore represents a promising target for future pain therapy. MRGPR-X1 is activated by bovine adrenal medulla peptide-8-22 (BAM 8-22) which is cleaved from pro-enkephalin by pro-hormone convertases. Unlike most if not all Gq-coupled receptors MRGPR-X1 does not undergo agonist-promoted endocytosis. Data: Western blot analysis of rat brain preparation. Lane 1: Rat brain preparation (20µg). Secondary: Goat anti-rabbit IgG conjugated to HRP 1:5000.</p>

<p>2A peptide-linked polycistronic vectors can be used to express multiple proteins from a single open reading frame (ORF). The small 2A peptide sequences, when cloned between genes, allows for efficient, stoichiometric production of discrete protein products within a single vector through a novel "cleavage" event within the 2A peptide sequence. 2A was discovered in the foot-and-mouth disease virus (FMDV, a picornavirus). The 2A peptide acts through ribosomal skipping to allow for the encoding of polyproteins which can dissociate into individual proteins upon translation. Anti-T2A antibody recognises 2A tagged recombinant proteins and is an excellent tool for researchers using 2A peptide based expression systems.<br>0.2mg/ml TEA (Rb L02T), 0.5mg/ml Glycine (Rb L02G). Used for ELISA (1:1000). Reacts with T2A tag.</p>

<p>The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding d</p>

<p>p38 MAP kinase (MAPK) is the mammalian orthologue of the yeast HOG kinase that participates in a signaling cascade controlling cellular responses to cytokines and stress. Isoforms p38α, β, γ and δ have been identified. p38 MAPK is activated by a variety of cellular stresses including osmotic shock, inflammatory cytokines, lipopolysaccharide (LPS), UV light, and growth factors.</p>

<p>The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2008],</p>

<p>This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008],</p>

<p>This gene encodes a class I seven-transmembrane G-protein-coupled receptor. The encoded protein is a receptor for angiotensin-(1-7) and preferentially couples to the Gq protein, activating the phospholipase C signaling pathway. The encoded protein may play a role in multiple processes including hypotension, smooth muscle relaxation and cardioprotection by mediating the effects of angiotensin-(1-7). [provided by RefSeq, May 2012],</p>

<p>Activation of caspase-3 requires proteolytic processing of its inactive zymogen into activated p17 and p12 fragments. Cleavage of caspase-3 requires aspartic acid at the P1 position.</p>

<p>This gene encodes the 125-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6. [provided by RefSeq, Mar 2012],</p>

<p>caution:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.,function:Location-regulated scaffolding protein connecting MEK to RAF. Promotes MEK and RAF phosphorylation and activity through assembly of an activated signaling complex. By itself, it has no demonstrated kinase activity.,PTM:Phosphorylated on Ser-309 and, to a higher extent, on Ser-404 by MARK3. Dephosphorylated on Ser-404 by PPP2CA. In resting cells, phosphorylated KSR1 is cytoplasmic and in stimulated cells, dephosphorylated KSR1 is membrane-associated.,similarity:Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.,similarity:Contains 1 phorbol-ester/DAG-type zinc finger.,similarity:Contains 1 protein kinase domain.,subcellular location:In unstimulated cells, where the phosphorylated form is bound to a 14-3-3 protein, sequestration in the cytoplasm occurs. Following growth factor treatment, the protein is free for membrane translocation, and it moves from the cytoplasm to the cell periphery.,subunit:Interacts with HSPCA/HSP90, YWHAB/14-3-3, CDC37, MAP2K/MEK, MARK3, PPP2R1A and PPP2CA. Also interacts with RAF and MAPK/ERK, in a Ras-dependent manner (By similarity). The binding of 14-3-3 proteins to phosphorylated KSR prevents the membrane localization.,</p>

<p>The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper</p>

<p>The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2011]</p>

<p>For use in ELISA</p>

<p>Component in the A549 HCP Western Blot Kit, F235</p>

<p>Affinity-purified goat antibody conjugated to HRP in a protein matrix with preservative, 50 ml, component in the E. coli Western Blot Kit, F415</p>

<p>Affinity-purified goat anti-PER.C6</p>

<p>Affinity-purified goat anti-CHO HCP</p>

<p>Affinity-purified goat anti-NS/0 HCP. This antibody is part of the NS/0 HCP ELISA Kit (F220).</p>

<p>For use in western blot analysis</p>

<p>For use in ELISA. Based on the anti-CHO HCP antibody utilized in CHO HCP ELISA, 3G (F550).</p>

<p>Affinity-purified rabbit antibody conjugated to HRP in a protein matrix with preservative, 12 ml</p>

<p>Placental lactogen antibody was raised in rabbit using human placental lactogen as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC); immunogen HIV gp41; IgG1</p>

<p>HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Rabbit anti Chicken IgY antibody</p>

<p>Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.</p>

<p>Digoxin antibody was raised in goat using digoxin-BSA as the immunogen.</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Mouse monoclonal HIV1 Nef N-terminal antibody (biotin)</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>Mouse monoclonal HIV1 rev antibody (HRP)</p>

<p>HIV1 rev antibody was raised in mouse using full length recombinant rev (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>Progesterone 17-OH antibody was raised in rabbit using 17-OH-Progesterone-3-CMO-BSA as the immunogen.</p>

<p>The ST2 antibody is a monoclonal antibody that has neutralizing properties against amyloid plaque. It works by binding to dopamine growth factor, which is present in human serum. This antibody is widely used in the field of life sciences for research purposes. Additionally, it has shown potential as an antiviral medicament due to its ability to inhibit the replication of certain viruses. The ST2 antibody can be used in various applications, including immunoassays and diagnostic tests. Its high specificity and affinity make it a valuable tool for studying alpha-fetoprotein and other biomarkers. With its carbon electrode technology, this monoclonal antibody offers enhanced sensitivity and accuracy in detecting target molecules.</p>

<p>Cortisol 3 antibody was raised in mouse using cortisol-3-BSA as the immunogen.</p>

<p>Polyclonal Phosphotyrosine antibody</p>

<p>Sheep polyclonal HIV1 p24 antibody (FITC)</p>

<p>Thyroxine antibody is a highly reactive collagen-based monoclonal antibody used in Life Sciences research. It is commonly used for the detection and quantification of thyroxine levels in human serum samples. This antibody specifically targets and binds to thyroxine, preventing its interaction with other molecules. The immobilization of this antibody on an electrode surface allows for efficient and sensitive detection of thyroxine levels. Additionally, studies have shown that this antibody has neutralizing effects on interleukin-6, a pro-inflammatory cytokine involved in various diseases. Furthermore, it has been observed that the binding of this antibody to thyroxine can inhibit the production of reactive oxygen species, making it potentially useful in antioxidant therapies.</p>

<p>PTH antibody was raised in goat using glandular PTH as the immunogen.</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>Chymotrypsin antibody was raised in rabbit using pancreatic chymotrypsin as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Donkey anti-goat IgG was raised in donkey using highly pure goat IgG as the immunogen.</p>

<p>Goat polyclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>Goat polyclonal cAMP antibody</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>hCG antibody was raised in mouse using hCG affinity pure from pregnancy urine as the immunogen.</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>ApoA-II antibody was raised in goat using highly purified human APO A-II as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>COX2 antibody was raised in mouse using recombinant human COX 2 protein as the immunogen.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Goat anti Human IgM + IgD antibody</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>HSV2 gD antibody was raised in mouse using herpes simplex virus 2 glycoprotein D (gD) as the immunogen.</p>

<p>Human monoclonal antibody targeting activin receptor type-2B; treatment of muscle loss and weakness</p>

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>Calcitonin antibody is a monoclonal antibody that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody has been extensively studied and shown to have high affinity for calcitonin, making it an effective tool for research and diagnostic purposes.<br><br>One of the key characteristics of this antibody is its ability to detect autoantibodies against calcitonin in human serum. These autoantibodies are associated with certain autoimmune disorders and can provide valuable insights into disease progression and treatment options.<br><br>Additionally, this antibody has been used in studies involving basic protein research. It can effectively bind to calcitonin and other related proteins, enabling researchers to study their functions and interactions.<br><br>Moreover, the calcitonin antibody has been utilized as a tool in various immunoassays. It can be conjugated with different labels such as biotin or fluorescent dyes, allowing for easy detection and quantification of calcitonin levels in biological samples.<br><br>Furthermore, this antibody has neutral</p>

<p>Mouse monoclonal CD8 antibody (biotin)</p>

<p>Goat polyclonal Properdin antibody</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH as the immunogen.</p>

<p>Goat polyclonal Whole Human Serum antibody</p>

<p>Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.</p>

<p>FSH Beta antibody was raised in rabbit using FSH beta-KLH as the immunogen.</p>

<p>BGH antibody was raised in rabbit using bovine growth hormone as the immunogen.</p>

<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>

<p>The HIV1 tat antibody is a protein that belongs to the oncostatin and natriuretic family. It acts as a kinase inhibitor and is available as both a monoclonal antibody and polyclonal antibodies in the field of Life Sciences. This antibody specifically targets the tat protein of HIV-1, which plays a crucial role in viral replication and immune evasion. By binding to the tat protein, this antibody inhibits its function and prevents viral replication.</p>

<p>HIV1 p24 antibody (FITC) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>THC antibody was raised in sheep using tetrahydrocannabinol-KLH as the immunogen.</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Goat anti Human IgA antibody</p>

<p>Orosomucoid antibody was raised in rabbit using rat alpha-1 acid glycoprotein as the immunogen.</p>

<p>Goat anti Mouse IgG (H + L) secondary antibody (HRP)</p>

<p>Mouse monoclonal HIV1 rev antibody (biotin); concentration 50 ug/vial</p>

<p>CMV p28 UL99 antibody was raised in mouse using cytomegalovirus minor capsid protein p28 as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>HSV1 gC antibody was raised in mouse using herpes simplex virus gC-1 as the immunogen.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>SIV mac251 p28 antibody was raised in rabbit using full length recombinant p28 (SIVmac251) as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>

<p>Goat polyclonal BNP antibody</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>Theophylline 8 antibody was raised in rabbit using theophylline-8 as the immunogen.</p>

<p>Histone-H-3 antibody was raised in sheep using Intact calf histone H3 complexed with RNA as the immunogen.</p>

<p>Vitamin B12 antibody was raised in rabbit using Vitamin B12-BSA as the immunogen.</p>

<p>FITC antibody was raised in rabbit using fluorescein isothiocyanate-KLH as the immunogen.</p>

<p>Goat polyclonal HIV2 gp105 antibody</p>

<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>

<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>

<p>CEA antibody was raised in goat using human CEA as the immunogen.</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp120 protein (biotin)</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.</p>

<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Mouse monoclonal SIV mac251 gp120 antibody (HRP)</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Rabbit polyclonal Phosphatidylserine antibody</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody</p>

<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Guinea pig polyclonal Goat Serum antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>CKMM antibody was raised in goat using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.</p>

<p>Mouse monoclonal HIV1 integrase antibody (HRP)</p>

<p>Estradiol antibody was raised in rabbit using estradiol-6-protein preparation as the immunogen.</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 100 ug per vial; clone 45</p>

<p>Rabbit Polyclonal Phosphotyrosine antibody</p>