Anticuerpos primarios

<p>Goat anti-rat IgG was raised in goat using highly pure rat IgG as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that exhibits cytotoxic properties against the Ebola virus. This antibody specifically targets and neutralizes the glycoprotein present on the surface of the virus, preventing it from infecting host cells.</p>

<p>Goat polyclonal HIV1 antibody</p>

<p>Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.</p>

<p>Mouse monoclonal HIV1 integrase antibody (HRP)</p>

<p>Goat anti Human IgM antibody</p>

<p>CKMM antibody was raised in rabbit using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>

<p>Goat polyclonal CRP antibody</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Goat polyclonal Digoxin antibody</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Estradiol-6 antibody was raised in rabbit using 17 beta-Estradiol-6-BSA as the immunogen.</p>

<p>Rabbit polyclonal HIV2 gp105 antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Luteinizing hormone antibody was raised in rabbit using LH beta-KLH as the immunogen.</p>

<p>CKBB antibody was raised in rabbit using human CKBB from the brain as the immunogen.</p>

<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>

<p>The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola.</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>Mouse monoclonal HIV1 rev antibody (HRP)</p>

<p>Rabbit polyclonal HIV-2 antibody (biotin)</p>

<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (FITC)</p>

<p>HSV2 gD antibody was raised in mouse using herpes simplex virus 2 glycoprotein D (gD) as the immunogen.</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Luteinizing hormone beta antibody was raised in goat using human LH beta as the immunogen.</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>Goat polyclonal Human Ferritin antibody</p>

<p>The hCG beta antibody is a monoclonal antibody that specifically targets and neutralizes the human chorionic gonadotropin (hCG) beta subunit. This antibody is known to form dimers, which enhance its binding affinity and neutralizing activity against hCG. It has been widely used in life sciences research to study the role of hCG in various biological processes.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>TSH beta antibody was raised in mouse using human TSH beta as the immunogen.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>Histone 2B antibody was raised in sheep using Intact calf histone H2B-rRNA complex as the immunogen.</p>

<p>FBP antibody was raised in rabbit using bovine milk as the immunogen.</p>

<p>Cocaine antibody was raised in goat using cocaine-KLH as the immunogen.</p>

<p>Borrelia burgdorferi antibody was raised in sheep using lyme disease (Borrelia Burdorferi) as the immunogen.</p>

<p>Sheep polyclonal HIV1 p24 antibody (FITC)</p>

<p>PAP antibody was raised in goat using human PAP as the immunogen.</p>

<p>HIV1 p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the human immunodeficiency virus (HIV-1). This antibody has been widely used in research and diagnostic applications in the field of life sciences. It can be used for various purposes, such as detecting the presence of HIV-1 infection, studying viral replication and pathogenesis, and developing new therapeutic approaches. The HIV1 p24 antibody exhibits high specificity and sensitivity, making it a valuable tool for researchers and healthcare professionals working in the field of HIV/AIDS. Additionally, this antibody has cytotoxic properties that can be utilized for targeted therapy against HIV-infected cells. Its unique ability to bind to the p24 protein with high affinity makes it an essential component in the development of diagnostic tests and potential treatments for HIV/AIDS.</p>

<p>Rabbit polyclonal BNP antibody</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Estradiol 6,17 b antibody was raised in rabbit using Estradiol-17 beta-6-CMO-BSA as the immunogen.</p>

<p>Triiodothyronine antibody was raised in goat using triiodothyronine-BSA as the immunogen.</p>

<p>Goat anti Human IgG Fc + IgD antibody</p>

<p>Gastrin antibody was raised in rabbit using human gastrin as the immunogen.</p>

<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>

<p>SIV mac251 gp120 antibody was raised in rabbit using purified, full length recombinant gp120 (SIV-1mac251) produced in baculovirus expression system as the immunogen.</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Rabbit anti Chicken IgY antibody</p>

<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Goat polyclonal Human  Complement 3D antibody</p>

<p>E. coli antibody was raised in mouse using E. coli shigatoxin as the immunogen.</p>

<p>CEA antibody was raised in goat using human CEA as the immunogen.</p>

<p>Humanized anti-CD19 IgG1 monoclonal antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Goat polyclonal Human ApoB antibody</p>

<p>Anti-activated leukocyte cell adhesion mlecule (ALCAM/CD116) monoclonal antibody</p>

<p>HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>HIV1 Nef antibody (FITC) was raised using purified recombinant nef (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>The HRP2 antibody is an immobilized monoclonal antibody used in Life Sciences. It is specifically designed to target interferon-gamma (IFN-gamma), a cytokine involved in immune response regulation. This antibody can be used for various applications, including the detection and quantification of IFN-gamma in biological samples. Additionally, the HRP2 antibody has been shown to bind to virus surface antigens, insulin-like growth factors, fatty acids, and hormone peptides. Its high specificity and affinity make it a valuable tool in research and diagnostics. Furthermore, this antibody has also been demonstrated to be effective against alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. With its versatility and wide range of applications, the HRP2 antibody is an essential component for any laboratory working in the field of immunology and molecular biology.</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Goat anti Human IgE antibody</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>DYRK1B antibody was raised in Rabbit using Human DYRK1B as the immunogen</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>