Anticuerpos primarios

<p>Testosterone antibody was raised in sheep using 11-beta hydroxytestosterone as the immunogen.</p>

<p>Goat anti Human kappa + lambda light chain secondary antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Digoxin antibody was raised in goat using digoxin-BSA as the immunogen.</p>

<p>Goat anti Human IgM + IgD antibody</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody</p>

<p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>hCG Alpha antibody was raised in goat using Alpha subunit of HCG as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Luteinizing hormone beta antibody was raised in goat using human LH beta as the immunogen.</p>

<p>Thyroxine antibody was raised in sheep using T4-BSA as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Estradiol-6 antibody was raised in rabbit using 17 beta-Estradiol-6-BSA as the immunogen.</p>

<p>HIV1 tat antibody was raised in rabbit using purified, full length recombinant TAT (HIV-1) as the immunogen.</p>

<p>CKBB antibody was raised in rabbit using human CKBB from the brain as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Luteinizing hormone antibody was raised in rabbit using LH beta-KLH as the immunogen.</p>

<p>Primidone antibody was raised in goat using primidoen-KLH as the immunogen.</p>

<p>Goat polyclonal HIV1 antibody</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Phosphothreonine antibody was raised in rabbit using phosphothreoning as the immunogen.</p>

<p>Goat polyclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>Mouse monoclonal HIV1 rev antibody (biotin); concentration 50 ug/vial</p>

<p>HIV1 rev antibody (FITC) was raised in rabbit using full length recombinant rev (HIV-1, HxB2, HxB3) produced in E. coli expression system as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Mouse monoclonal HIV1 Nef N-terminal antibody (biotin)</p>

<p>Rabbit polyclonal Phosphatidylserine antibody</p>

<p>DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 50 ug/vial; clone 4</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>Nortestosterone antibody was raised in rabbit using 19-nortestosterone-17-KLH as the immunogen.</p>

<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>Polyclonal Phosphotyrosine antibody</p>

<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>

<p>Mouse monoclonal HIV1-RT antibody (biotin)</p>

<p>HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>

<p>HIV1-RT antibody (FITC) was raised in mouse using purified, full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.</p>

<p>COX2 antibody was raised in mouse using recombinant human COX 2 protein as the immunogen.</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.</p>

<p>Progesterone 17-OH antibody was raised in rabbit using 17-OH-Progesterone-3-CMO-BSA as the immunogen.</p>

<p>Histone 2B antibody was raised in sheep using Intact calf histone H2B-rRNA complex as the immunogen.</p>

<p>Goat polyclonal Human Plasminogen antibody</p>

<p>HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.</p>

<p>The HIV1 tat antibody is a protein that belongs to the oncostatin and natriuretic family. It acts as a kinase inhibitor and is available as both a monoclonal antibody and polyclonal antibodies in the field of Life Sciences. This antibody specifically targets the tat protein of HIV-1, which plays a crucial role in viral replication and immune evasion. By binding to the tat protein, this antibody inhibits its function and prevents viral replication.</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Rabbit anti-guinea pig IgG (H+L) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>Goat polyclonal Human Complement C4 antibody</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Progesterone antibody was raised in rabbit using progesterone as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>Furosemide antibody was raised in rabbit using furosemide-KLH as the immunogen.</p>

<p>Rabbit polyclonal NFkB regulatory factor antibody</p>

<p>HSV1 + HSV2 ICP35 antibody was raised in mouse using herpes simplex virus ICP35 as the immunogen.</p>

<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>

<p>Goat polyclonal BNP antibody</p>

<p>CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.</p>

<p>Plasminogen antibody was raised in goat using plasminogen isolated from normal human Plasma as the immunogen.</p>

<p>HIV1 integrase antibody was raised in mouse using full length recombinant Integrase (HIV-1, IIIB) as the immunogen.</p>

<p>Mouse monoclonal HIV1 Nef C-terminal antibody (biotin)</p>

<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>

<p>Histone-H-3 antibody was raised in sheep using Intact calf histone H3 complexed with RNA as the immunogen.</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>

<p>Digitoxigenin antibody was raised in goat using digitoxigenin as the immunogen.</p>

<p>Theophylline 8 antibody was raised in rabbit using theophylline-8 as the immunogen.</p>

<p>Mouse monoclonal Dengue NS1 antibody (Subtype 3).Supplied in PBS buffer with sodium azide</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Serotonin antibody was raised in sheep using serotonin-Tg as the immunogen.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Clonidine antibody was raised in rabbit using Clonidine-BSA as the immunogen.</p>

<p>Rabbit polyclonal HIV1-RT antibody</p>

<p>Progesterone antibody was raised in rabbit using 17a-OH progesterone -3-CMO-BSA as the immunogen.</p>

<p>Goat polyclonal Whole Human Serum antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>