Anticuerpos primarios

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>Goat polyclonal anti Human lambda light chain antibody</p>

<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>Triiodothyronine antibody was raised in goat using triiodothyronine-BSA as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Digitoxigenin antibody was raised in goat using digitoxigenin as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Goat polyclonal cAMP antibody</p>

<p>CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.</p>

<p>Rabbit polyclonal HIV2 ROD Rev antibody (biotin)</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3-oxime albumin as the immunogen.</p>

<p>Goat anti Mouse IgG antibody</p>

<p>PTH antibody was raised in rabbit using hPTH as the immunogen.</p>

<p>HIV1 integrase antibody was raised in mouse using full length recombinant Integrase (HIV-1, IIIB) as the immunogen.</p>

<p>Clonidine antibody was raised in rabbit using Clonidine-BSA as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>CRP antibody was raised in Goat using C-Reactive Protein purified from normal human Plasma/Serum as the immunogen.</p>

<p>Goat anti Human kappa + lambda light chain secondary antibody</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>Cortisol 3 antibody was raised in mouse using cortisol-3-BSA as the immunogen.</p>

<p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (HRP)</p>

<p>Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>PAP antibody was raised in rabbit using affinity purified PAP as the immunogen.</p>

<p>Goat polyclonal Whole Human Serum antibody</p>

<p>HIV2 gp105 antibody was raised in rabbit using purified, full length recombinant gp105 (HIV-2 ROD) as the immunogen.</p>

<p>CKBB antibody was raised in rabbit using human CKBB from the brain as the immunogen.</p>

<p>Goat polyclonal Properdin antibody</p>

<p>Sheep polyclonal HIV1 p24 antibody (FITC)</p>

<p>Luteinizing hormone antibody was raised in rabbit using LH beta-KLH as the immunogen.</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>Mouse monoclonal HIV2 gp36 antibody</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>THC antibody was raised in goat using delta-6-Tetrahydrocannabinol-KLH as the immunogen.</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Rabbit polyclonal Phosphatidylserine antibody</p>

<p>Chymotrypsin antibody was raised in rabbit using pancreatic chymotrypsin as the immunogen.</p>

<p>Mouse monoclonal HIV1-RT antibody (HRP)</p>

<p>Estradiol-6 antibody was raised in rabbit using 17 beta-Estradiol-6-BSA as the immunogen.</p>

<p>PTH antibody was raised in goat using glandular PTH as the immunogen.</p>

<p>HSV1 + HSV2 ICP35 antibody was raised in mouse using herpes simplex virus ICP35 as the immunogen.</p>

<p>Polyclonal Myoglobin antibody</p>

<p>DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.</p>

<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Goat polyclonal Human Cystatin C antibody</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>hCG Alpha antibody was raised in goat using Alpha subunit of HCG as the immunogen.</p>

<p>Goat anti Human IgM + IgD antibody</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Plasminogen antibody was raised in goat using plasminogen isolated from normal human Plasma as the immunogen.</p>

<p>Gastrin antibody was raised in rabbit using human gastrin as the immunogen.</p>

<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Goat polyclonal BNP antibody</p>

<p>Rabbit polyclonal NFkB regulatory factor antibody</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>The CD8 antibody is a highly specialized monoclonal antibody that targets the glycoprotein CD8 on the surface of cytotoxic T cells. This antibody has been widely used in various life science research applications, including immunoassays and flow cytometry.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>This polyclonal antibody product: affinity purified Sheep Anti-HIV-1-gp120 was produced by first immunizing sheep with a single synthetic peptide which has the amino acid sequence: APTKAKRRVVQREKR. This amino acid sequence corresponds to amino acid section 497-511 in the envelope gene gp120 protein of the BH-10 strain of HIV-1. The antibodies are then isolated from the sheep hyperimmune serum by affinity chromatography using the APTKAKRRVVQREKR sequenced synthetic peptide coupled to Sepharose. The serological activity of the antibodies is checked by ELISA and lyophilized in PBS. 0.15M NaCl (pH 7.4) without preservative.<br>The glycoprotein gp120 is an essential Human Immunodeficiency virus (HIV) envelope subunit which facilitates the entry of the HIV into CD4 T cells through binding to CD4 receptors and CCR5 or CXCR4 chemokine co-receptors on host cells. This attachment enables the second key envelope glycoprotein gp41 to form a six-helix bundle and therefore fuse to the host cell membrane. This HIV gp120 complementary antibody can be used to detect the presence of the HIV gp120 subunit in antigen detection assays such as ELISA, automated immunoassays, western blot and lateral flow.</p>

<p>Mouse monoclonal HIV2 gp26 antibody</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.</p>

<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 100 ug per vial; clone 45</p>

<p>Estradiol antibody was raised in rabbit using estradiol-6-protein preparation as the immunogen.</p>

<p>Human IgG1 anti-CD52 monoclonal antibody</p>

<p>HIV1 p24 antibody (biotin) was raised in mouse using purified full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Phosphothreonine antibody was raised in rabbit using phosphothreoning as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>

<p>Progesterone antibody was raised in rabbit using 17a-OH progesterone -3-CMO-BSA as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Mouse monoclonal SIV mac251 gp120 antibody (HRP)</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>Estradiol 6,17 b antibody was raised in rabbit using Estradiol-17 beta-6-CMO-BSA as the immunogen.</p>

<p>Progesterone 17-OH antibody was raised in rabbit using 17-OH-Progesterone-3-CMO-BSA as the immunogen.</p>

<p>Serotonin antibody was raised in sheep using serotonin-Tg as the immunogen.</p>

<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>

<p>HIV1 p24 antibody was raised in goat using p24 (HIV-1 IIIB) as the immunogen.</p>

<p>Goat polyclonal Human Plasminogen antibody</p>

<p>Goat polyclonal Human Complement C4 antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>TSH antibody was raised in goat using human TSH whole molecule as the immunogen.</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>