Anticuerpos primarios

<p>The GFR antibody is a highly specialized antibody used in the field of Life Sciences. It can be either polyclonal or monoclonal, depending on the specific application. This antibody has neutralizing properties and is designed to target and bind to chemokines, which are low-molecular-weight proteins involved in cell signaling. The GFR antibody can also interact with growth factors such as TGF-beta and EGF-like proteins, inhibiting their activity.</p>

<p>Ebf3 antibody was raised in rabbit using the N terminal of Ebf3 as the immunogen</p>

<p>Rabbit polyclonal ZNF541 antibody</p>

<p>LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK</p>

<p>The CENPE Antibody is a highly effective inhibitor and reagent that serves as a valuable biomarker in the field of Life Sciences. This monoclonal antibody is specifically designed to target and inhibit CENPE, a key protein involved in the regulation of hematopoietic and pluripotent stem cells. With its high specificity and affinity, this antibody can be used for various applications including immunohistochemical staining and detection of CENPE expression in different cell types.</p>

<p>The POT1 antibody is a growth factor that belongs to the class of Polyclonal Antibodies. It forms dimers with calmodulin and has cytotoxic properties. This antibody is widely used in Life Sciences research, particularly in studies related to epidermal growth factor. It can be used as a monoclonal antibody or in combination with other antibodies. The POT1 antibody has neutralizing effects on human serum and has been shown to inhibit the activity of electrode and gm-csf colony-stimulating factor. Furthermore, it has been found to have potential therapeutic applications in the treatment of autoimmune diseases associated with autoantibodies.</p>

<p>Itih1 antibody was raised in rabbit using the middle region of Itih1 as the immunogen</p>

<p>Transferrin antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms, offering versatile options for various applications. This antibody has the unique ability to neutralize transferrin, a glycoconjugate involved in iron transport. By binding to transferrin, the antibody prevents its activation and subsequent cytotoxic effects.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its effectiveness through various techniques such as patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>PRRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILL</p>

<p>EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen</p>

<p>Rabbit Polyclonal Tsc2 antibody (Ser939)</p>

<p>The PTPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both a monoclonal and polyclonal antibody. This antibody specifically targets and binds to the PTPN2 protein, which plays a crucial role in various biological processes.</p>

<p>The IkB alpha antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activated form of IkB alpha, a protein that plays a crucial role in cellular signaling pathways. By binding to IkB alpha, this antibody prevents its interaction with 14-3-3 isoforms, thereby inhibiting downstream signaling events.</p>

<p>Purified Polyclonal PFKFB1/4 antibody</p>

<p>WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA</p>

<p>Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS</p>

<p>C20ORF10 antibody was raised using the N terminal Of C20Orf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN</p>

<p>TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen</p>

<p>TBCA antibody was raised in mouse using recombinant TBCA (1-108aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>PUMA antibody was raised in rabbit using 17 residue sequence 29-55 [EQHLESPVPSAPGALAG] found in the exon-3-encoded region in the human PUMA-Alpha and PUMA-Beta forms of the protein as the immunogen.</p>

<p>The NFkB p65 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and has been shown to inhibit endonuclease activity associated with EGF-like molecules.</p>

<p>The Vimentin antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets vimentin, an intermediate filament protein found in various cell types. It has been extensively used to study the expression and localization of vimentin in different tissues and cell lines.</p>

<p>Rabbit polyclonal SLC12A4 antibody</p>

<p>Neurocan Monoclonal Antibody</p>

<p>CD3e antibody was raised in rat using CD3e as the immunogen.</p>

<p>The MEK1 antibody is a powerful tool used in various scientific and medical research applications. This antibody specifically targets the MEK1 protein, which plays a crucial role in cell signaling pathways. By binding to the MEK1 protein, this antibody can effectively block its activity and provide valuable insights into cellular processes.</p>

<p>ZBTB6 antibody was raised in rabbit using the N terminal of ZBTB6 as the immunogen</p>

<p>The HBP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, offering researchers different options for their specific needs. This antibody targets the fibroin protein, which plays a crucial role in various cellular processes.</p>

<p>NOSIP antibody was raised in rabbit using the middle region of NOSIP as the immunogen</p>

<p>Mouse monoclonal TPSG1 antibody</p>

<p>Rabbit polyclonal TROAP antibody</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ</p>

<p>Alien antibody was raised in rabbit using Residues 239-250 [ECGGKMHLREGE] of Alien as the immunogen.</p>

<p>ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA</p>

<p>PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG</p>

<p>The GLP1 antibody is a low-molecular-weight chemokine that belongs to the class of monoclonal antibodies. It is specifically designed to target and neutralize the growth factor known as epidermal growth factor (EGF). This antibody has been shown to have antiangiogenic properties, meaning it can inhibit the formation of new blood vessels that are necessary for tumor growth. Additionally, the GLP1 antibody can induce apoptosis, or programmed cell death, in cancer cells by activating caspase-9. This monoclonal antibody has been extensively studied in the field of life sciences and has shown promising results as a potential therapeutic agent for various types of cancers.</p>

<p>The IL1 beta antibody is a monoclonal antibody that specifically targets and binds to IL1 beta, an inflammatory cytokine involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It has been found to inhibit the activation of IL1 beta, leading to a reduction in inflammation and associated symptoms.</p>

<p>C7ORF38 antibody was raised using the middle region of C7Orf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV</p>

<p>Purified Polyclonal SFT2D2 antibody</p>

<p>BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN</p>

<p>Rabbit polyclonal WRN antibody (Ser1141)</p>

<p>GRK7 antibody was raised in rabbit using the C terminal of GRK7 as the immunogen</p>

<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>Purified Polyclonal FXR2 antibody</p>

<p>GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV</p>

<p>The TGFBR2 antibody is a polyclonal antibody that specifically targets the transforming growth factor beta receptor 2 (TGFBR2). It is commonly used in research and diagnostic applications to detect and quantify the expression of TGFBR2. This antibody binds to the activated form of TGFBR2, inhibiting its interaction with other proteins involved in signal transduction pathways. Additionally, it has been shown to block the binding of interferon-gamma (IFN-gamma) to TGFBR2, suggesting a potential role in modulating immune responses. The TGFBR2 antibody is available as both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it a valuable tool for studying the function and regulation of TGFBR2 in various biological systems.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK</p>

<p>Rabbit polyclonal CRP antibody (Prediluted for IHC)</p>

<p>Purified Polyclonal BCAS2 antibody</p>

<p>Purified Polyclonal Delta Opioid Receptor antibody</p>

<p>PKC epsilon antibody is a polyclonal antibody that specifically targets the MERTK protein. This antibody is commonly used in life sciences research to study the role of MERTK in various cellular processes. MERTK is a receptor tyrosine kinase involved in the regulation of cell growth, survival, and differentiation. It plays a crucial role in the immune response, particularly in the clearance of apoptotic cells and antiviral defense mechanisms mediated by interferon signaling. The PKC epsilon antibody has been shown to be highly reactive and exhibits strong binding affinity towards MERTK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry analysis. Researchers can rely on this high-quality antibody to accurately detect and quantify MERTK expression levels in different tissues or cell types. Its specificity and reliability make it an invaluable tool for studying the function and regulation of MERTK in various biological processes.</p>

<p>Rabbit Polyclonal Bcr antibody (Tyr177)</p>

<p>The MKK3 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor and progesterone. It is commonly used in immunoassays and research studies within the field of Life Sciences. This antibody specifically binds to MKK3, a phosphatase enzyme involved in various cellular processes such as chemokine signaling and interferon response. The MKK3 antibody has been extensively validated for its specificity and sensitivity in detecting activated MKK3 in human serum samples. Additionally, it can be utilized as a valuable tool for studying the role of MKK3 in different biological pathways and for developing potential inhibitors targeting this enzyme. With its high-quality performance, this polyclonal antibody is an essential component for any researcher working in the field of Life Sciences.</p>

<p>The CDK2 antibody is a highly specialized monoclonal antibody that targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody is widely used in life sciences research to study the role of CDK2 in various cellular processes.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>The EFNA5 antibody is a highly specialized polyclonal antibody that targets EFNA5, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and neutralizing EFNA5 in different research applications.</p>

<p>Purified Polyclonal NXPH1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>The JAK3 antibody is a monoclonal antibody that specifically targets the activated form of the JAK3 protein. This antibody is commonly used in research and diagnostic applications to detect and quantify the presence of JAK3 in human serum samples. The JAK3 antibody can be immobilized on an electrode or colloidal surface to create a sensitive and specific assay for detecting JAK3 levels. It is also used in studies investigating growth factors, autoantibodies, and collagen-related diseases. The high specificity and affinity of this monoclonal antibody make it an essential tool for researchers studying helicobacter infections and other diseases involving the JAK3 pathway. Additionally, the JAK3 antibody can be used in combination with other antibodies, such as polyclonal antibodies, to enhance detection sensitivity and accuracy.</p>

<p>Purified Polyclonal ABHD14A antibody</p>

<p>The NP antibody is a monoclonal antibody that specifically targets antiphospholipid antibodies. It is designed to recognize and bind to glycopeptides and glycoproteins associated with these autoantibodies. The NP antibody has cytotoxic properties and can be used for various applications in research and diagnostics.</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>

<p>LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT</p>

<p>Purified Rabbit polyclonal WRKY67.1 antibody</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>ZNF185 antibody was raised in rabbit using the N terminal of ZNF185 as the immunogen</p>

<p>Ssr2 antibody was raised in rabbit using the C terminal of Ssr2 as the immunogen</p>

<p>CLASP2 antibody was raised in Rabbit using Human CLASP2 as the immunogen</p>

<p>Purified Rabbit polyclonal eEF1 alpha antibody</p>

<p>HOMEZ antibody was raised in rabbit using the N terminal of HOMEZ as the immunogen</p>

<p>MMP9 antibody was raised in mouse using a synthetic peptide corresponding to amino acid 626-644 of human MMP9 as the immunogen.</p>

<p>Chlamydia pneumoniae antibody was raised in Mouse using Chlamydia pneumoniae (TWAR) as the immunogen.</p>

<p>The LATS antibody is a polyclonal antibody that is used in life sciences research. It specifically targets alpha-fetoprotein, telomerase, chemokines, brain natriuretic peptide, and growth factor-1 receptor. This antibody is widely used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It has been shown to be highly specific and sensitive in detecting its target proteins in human serum samples. The LATS antibody can be used to study the role of these proteins in various physiological processes and diseases. With its high-quality performance and reliable results, this antibody is an essential tool for researchers in the field of life sciences.</p>

<p>Rabbit polyclonal RGS10 antibody</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>The CDC37 antibody is a growth factor that plays a crucial role in various biological processes. It is a colloidal fatty acid that regulates thrombocytopenia, chemokine production, and interleukin-6 signaling. The CDC37 antibody is a monoclonal antibody that specifically targets the family kinase inhibitor, collagen, and other growth factors. It can be used in research and diagnostic applications to study the effects of these proteins on cell signaling pathways. Additionally, polyclonal antibodies against CDC37 are available for use in various immunoassays. With its high viscosity and potent inhibitory properties, the CDC37 antibody is an essential tool for scientists studying growth factor-related processes.</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>ERAP1 antibody was raised in Rabbit using Human ERAP1 as the immunogen</p>

<p>The IL31RA antibody is a monoclonal antibody that specifically targets the IL-31 receptor alpha (IL31RA). This antibody is designed to block the binding of IL-31, a cytokine involved in inflammation and itching, to its receptor. By inhibiting this interaction, the IL31RA antibody can potentially alleviate symptoms associated with inflammatory skin conditions such as atopic dermatitis.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting strong bactericidal activity. Through transcription-quantitative polymerase chain techniques, its high frequency of human activity has been verified. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS</p>

<p>Rabbit polyclonal RAPGEFL1 antibody</p>

<p>Rabbit polyclonal ATG4C antibody</p>

<p>LDLRAD1 antibody was raised in Rabbit using Human LDLRAD1 as the immunogen</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>Mouse monoclonal CBR3 antibody</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>FLJ12529 antibody was raised using the C terminal of FLJ12529 corresponding to a region with amino acids GASGSSSRKRHRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHE</p>

<p>The Vimentin antibody is a highly specific monoclonal antibody that targets the protein vimentin. Vimentin is an intermediate filament protein that plays a crucial role in maintaining the structural integrity of cells. This antibody has been widely used in various research fields, including Life Sciences and histidine studies.</p>

<p>NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR</p>

<p>Rabbit polyclonal ARMX3 antibody</p>

<p>The PLB antibody is a polyclonal antibody that specifically targets the cardiac sarcoplasmic reticulum. It is commonly used in life sciences research to study the antigen-antibody reaction and its role in various processes. This antibody can be used in immunoassays to detect and quantify the presence of specific antigens, such as chemokines or acetylcholine, in samples. Additionally, it can be conjugated with streptavidin for use in techniques like polymerase chain reactions (PCR) or Western blotting. The PLB antibody has also been studied for its potential therapeutic applications, such as targeting autoantibodies in human serum or enhancing the delivery of drugs like doxorubicin to cardiomyocytes. Its versatility and specificity make it an essential tool for researchers in the field of life sciences.</p>

<p>HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG</p>

<p>Reck antibody was raised in rabbit using the middle region of Reck as the immunogen</p>

<p>PDK1 antibody was raised using the middle region of PDK1 corresponding to a region with amino acids ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY</p>

<p>MAT2B antibody was raised using the middle region of MAT2B corresponding to a region with amino acids GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE</p>

<p>The RRM2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets the growth hormone receptor and has been shown to inhibit lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used in various applications such as immunohistochemistry and Western blotting. It is available both as polyclonal antibodies, which offer broad specificity, and monoclonal antibodies, which provide high specificity. The RRM2 antibody has also been studied as a potential therapeutic target for inhibiting tyrosine kinase activity and blocking endothelial growth factor signaling pathways. Additionally, it has been used in combination with other inhibitors, such as trastuzumab, to enhance their efficacy. With its versatility and potential applications, the RRM2 antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>OR2L8 antibody was raised in rabbit using the C terminal of OR2L8 as the immunogen</p>

<p>Rabbit polyclonal LAMA3 antibody</p>

<p>Rabbit polyclonal cJun antibody (Ser63)</p>

<p>Rabbit polyclonal NFKP p105/p50 antibody</p>

<p>IL21 antibody was raised in rabbit using highly pure recombinant murine IL-21 as the immunogen.</p>

<p>The ATF2 antibody is a potent diagnostic agent used in Life Sciences research. This polyclonal antibody specifically targets the amino-terminal region of ATF2, a transcription factor that plays a crucial role in regulating gene expression. By binding to ATF2, this antibody inhibits its activity and can be used to study the downstream effects of ATF2 inhibition.</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>HSF5 antibody was raised in rabbit using the middle region of HSF5 as the immunogen</p>

<p>OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS</p>

<p>The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.</p>

<p>The Fibronectin antibody is a monoclonal antibody that specifically targets fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin plays a crucial role in cell adhesion, migration, and tissue repair. This antibody can be used for various applications, including research and diagnostic purposes.</p>

<p>The FANCA antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to target and bind to the FANCA protein, which is involved in various cellular processes such as insulin-like growth factor signaling and DNA repair. This antibody has been extensively studied and proven to be effective in research related to trastuzumab, alpha-synuclein, and other proteins.</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>The HKR2 antibody is a specific antibody that has been widely used in Life Sciences research. It is a monoclonal antibody that specifically recognizes and binds to the HKR2 protein, which is involved in various cellular processes. This antibody can be used in different applications such as laser ablation, flow assays, and chemiluminescent immunoassays.</p>

<p>SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV</p>

<p>SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG</p>

<p>The PAK7 antibody is a highly specialized protein that plays a crucial role in various cellular processes. This monoclonal antibody has the ability to neutralize and immobilize PAK7 dimers, which are important for cell growth and survival. By targeting PAK7, this antibody can effectively inhibit its cytotoxic effects and prevent the activation of downstream signaling pathways.</p>

<p>Mouse monoclonal DFFA antibody</p>

<p>FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHI</p>

<p>DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF</p>

<p>The SirT1 antibody is a highly specialized tool used in life sciences research. It is a polyclonal antibody that specifically targets the Sirtuin 1 (SirT1) protein, which plays a crucial role in various cellular processes. This antibody can be used in a wide range of applications, including western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>C1ORF131 antibody was raised using the middle region of C1Orf131 corresponding to a region with amino acids TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV</p>

<p>SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Mouse monoclonal NEUROG1 antibody</p>

<p>SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW</p>

<p>The Tau antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has the ability to neutralize interferon and collagen, making it an essential component in the field of Life Sciences. This antibody is available both as polyclonal antibodies derived from human serum and as monoclonal antibodies.</p>

<p>The MEKK2 antibody is an immunomodulatory substance that targets a specific phosphorylation site on collagen. It is designed to recognize and bind to this site, leading to the modulation of immune responses. This antibody can be used in various applications, including research studies, vaccine development, and the production of therapeutic antibodies.</p>

<p>FMNL2 antibody was raised in Rabbit using Human FMNL2 as the immunogen</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>Purified Polyclonal ZNF280A antibody</p>

<p>ZMYND17 antibody was raised in rabbit using the C terminal of ZMYND17 as the immunogen</p>

<p>The PAR4 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Protease-Activated Receptor 4 (PAR4) in various biological processes. PAR4 plays a crucial role in cellular signaling pathways, particularly those involving epidermal growth factors and growth factors. By binding to PAR4, this antibody effectively inhibits its activation by proteases, preventing downstream effects such as the release of inflammatory cytokines and interferons.</p>

<p>Purified Polyclonal ARID4B antibody</p>

<p>The DCT antibody is a polyclonal antibody that specifically targets actin filaments. It is commonly used in Life Sciences research to study the activation and function of actin in various cellular processes. This antibody can be used for immunostaining, Western blotting, and other experimental techniques to visualize and quantify actin levels in cells and tissues.</p>

<p>CALB1 antibody was raised in rabbit using the C terminal of CALB1 as the immunogen</p>

<p>KEAP1 antibody was raised in rabbit using the N terminal of KEAP1 as the immunogen</p>

<p>ZNF75A antibody was raised in rabbit using the N terminal of ZNF75A as the immunogen</p>

<p>Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS</p>

<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI</p>

<p>LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE</p>

<p>TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC</p>

<p>Rabbit polyclonal PDGFR alpha antibody (Tyr754)</p>

<p>The VEGFR2 antibody is a polyclonal antibody that specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2). This receptor plays a crucial role in angiogenesis, which is the process of new blood vessel formation. The VEGFR2 antibody can be used in various life science applications to study the activation and signaling of this important growth factor.</p>

<p>MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE</p>

<p>Rabbit polyclonal Spermidine synthase antibody (HRP)</p>

<p>The cMyc antibody is a highly specialized molecule drug used in Life Sciences research. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and apoptosis. This antibody specifically targets the cMyc protein, which is involved in regulating gene expression.</p>

<p>Purified Polyclonal AKAP13 antibody</p>

<p>Purified Rabbit polyclonal OSGEPL1 antibody</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>Progesterone 11 alpha Monoclonal Antibody</p>

<p>Purified Polyclonal PRIM1 antibody</p>

<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>

<p>DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK</p>

<p>Rabbit Polyclonal NMDAR1 antibody (Ser897)</p>

<p>Oct 3/4 antibody was raised in rabbit using an internal sequence of the human Oct 3/4 protein as the immunogen.</p>

<p>POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL</p>

<p>LRRC37B antibody was raised using the N terminal of LRRC37B corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS</p>

<p>TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD</p>

<p>PREP antibody was raised using the middle region of PREP corresponding to a region with amino acids LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM</p>

<p>HMBS antibody was raised using the middle region of HMBS corresponding to a region with amino acids SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR</p>

<p>The mGLUR5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting the androgen receptor and exerting cytotoxic effects on specific cells. This antibody also has the ability to neutralize certain growth factors, interferons, hepatocyte growth factors, and chemokines. Additionally, it exhibits antiviral properties by targeting glycoproteins involved in viral replication. The mGLUR5 antibody is a versatile tool that can be utilized in various research applications, including multidrug resistance studies and electrode-based assays. Its high specificity and potency make it an invaluable asset for scientists working in diverse fields of study.</p>

<p>Ribophorin I antibody was raised using the middle region of RPN1 corresponding to a region with amino acids AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK</p>

<p>Rabbit polyclonal EPHB6 antibody</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Rabbit polyclonal Kinase E28 antibody</p>

<p>Rabbit polyclonal OR2T11 antibody</p>

<p>The STAT3 antibody is a highly specialized protein complex that specifically targets and neutralizes the activated form of the STAT3 protein. It is available in both polyclonal and monoclonal antibody forms, providing researchers with options for their specific experimental needs.</p>

<p>Rabbit polyclonal IGLL1 antibody</p>

<p>VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM</p>

<p>Purified Polyclonal IKK alpha antibody</p>

<p>MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI</p>

<p>Rabbit Polyclonal IKK alpha antibody (Ser180/181)</p>

<p>The GLUR2 antibody is a monoclonal antibody that has been developed to target atypical hemolytic. It specifically binds to low-density lipoprotein receptor-related protein 2 (GLUR2) and inhibits its protease activity. This antibody can be used in various life science applications, including research on epidermal growth factor and other growth factors. Additionally, the GLUR2 antibody can also be used to study autoantibodies and nuclear antibodies. It is a valuable tool for researchers in the field of life sciences and can be used in conjunction with other inhibitors or monoclonal antibodies such as trastuzumab.</p>

<p>CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL</p>

<p>MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP</p>

<p>Anti-Canine Corona Virus Antibody</p>

<p>RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG</p>

<p>Rabbit polyclonal Tau antibody (Thr205)</p>

<p>Purified Rabbit polyclonal PUB69 antibody</p>

<p>IKK-gamma antibody was raised in rabbit using residues 2-13 [NRHLWKSQLCEM] of the IKK-gamma protein as the immunogen.</p>

<p>The BAG4 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that has been extensively studied and proven to be effective in various research applications. This antibody specifically targets BAG family molecular chaperone regulator 4 (BAG4), which plays a crucial role in cell signaling and regulation.</p>

<p>Purified Polyclonal MKK1 antibody</p>

<p>RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogen</p>

<p>The GATA3 antibody is a highly specific and potent monoclonal antibody that targets the GATA3 protein. This protein is involved in various cellular processes, including the regulation of gene expression and cell differentiation. The GATA3 antibody has been extensively studied for its role in cancer research, particularly in breast cancer.</p>

<p>Purified Rabbit polyclonal MYB31 antibody</p>

<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>

<p>Rabbit polyclonal ATP6E antibody (FITC)</p>

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA</p>