Anticuerpos primarios

<p>SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED</p>

<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>

<p>Mouse monoclonal TXNRD2 antibody</p>

<p>LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK</p>

<p>Rabbit polyclonal RAB9A antibody</p>

<p>SLFN12 antibody was raised using the middle region of SLFN12 corresponding to a region with amino acids KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL</p>

<p>Purified Rabbit polyclonal MYB33 antibody</p>

<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI</p>

<p>The TDG antibody is a highly specific monoclonal antibody that targets the glycan structures on glycoproteins. It is widely used in life sciences research to study the role of glycans in various biological processes. The TDG antibody can be used for applications such as lectin blotting, glycan profiling, and immunohistochemistry. This antibody recognizes a polymorphic epitope that is activated by fatty acid treatment, making it a valuable tool for studying changes in glycosylation patterns. Additionally, the TDG antibody has been shown to interact with epithelial cadherin, suggesting a potential role in cell adhesion and signaling pathways. With its high specificity and sensitivity, this monoclonal antibody is an essential tool for researchers studying glycan-related processes in human proteins.</p>

<p>NUDT22 antibody was raised in rabbit using the C terminal of NUDT22 as the immunogen</p>

<p>Purified Polyclonal Radixin antibody</p>

<p>Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT</p>

<p>The EFNA5 antibody is a highly specialized polyclonal antibody that targets EFNA5, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and neutralizing EFNA5 in different research applications.</p>

<p>The MKK3 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor and progesterone. It is commonly used in immunoassays and research studies within the field of Life Sciences. This antibody specifically binds to MKK3, a phosphatase enzyme involved in various cellular processes such as chemokine signaling and interferon response. The MKK3 antibody has been extensively validated for its specificity and sensitivity in detecting activated MKK3 in human serum samples. Additionally, it can be utilized as a valuable tool for studying the role of MKK3 in different biological pathways and for developing potential inhibitors targeting this enzyme. With its high-quality performance, this polyclonal antibody is an essential component for any researcher working in the field of Life Sciences.</p>

<p>Rabbit polyclonal OR13C2 antibody</p>

<p>ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV</p>

<p>Purified Rabbit polyclonal MYB27 antibody</p>

<p>The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.</p>

<p>Rabbit polyclonal PLANH1 antibody (biotin)</p>

<p>PPA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT</p>

<p>Purified Rabbit polyclonal PUB72 antibody</p>

<p>The Ezrin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to ezrin, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathways, particularly endothelial growth factor (EGF). By blocking EGF signaling, the Ezrin antibody can prevent the proliferation and migration of cells, making it an ideal choice for research and therapeutic applications.</p>

<p>The TCTP antibody is a biochemical agent that targets the hyperpolarization-activated protein kinase. It belongs to the group of polyclonal antibodies and can be used for various applications, including research and diagnostic purposes. This antibody specifically recognizes TCTP (Translationally Controlled Tumor Protein), which has been found to play a role in various cellular processes such as cell growth, proliferation, and apoptosis.</p>

<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>

<p>Purified Rabbit polyclonal U12 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It stands out as the most effective rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its high activity in humans has been demonstrated through patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, thus inhibiting cell growth in culture.</p>

<p>C1ORF96 antibody was raised using the N terminal Of C1Orf96 corresponding to a region with amino acids LGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPP</p>

<p>The FOS antibody is a glycoprotein that belongs to the family of epidermal growth factor (EGF)-like antibodies. It contains sugar moieties that enhance its stability and functionality. This antibody has been shown to have endonuclease activity, which allows it to cleave DNA at specific sites. Additionally, it exhibits glutamate and hyaluronidase activity, making it useful in various biochemical assays. The FOS antibody can also be pegylated to increase its half-life and improve its pharmacokinetic properties. In life sciences research, this antibody is commonly used for immunostaining and Western blotting experiments. Its high specificity and affinity make it an excellent tool for studying protein expression patterns and understanding cellular signaling pathways. Furthermore, the FOS antibody has been shown to inhibit microvessel density and collagen synthesis, suggesting potential therapeutic applications in angiogenesis-related disorders. Its ability to modulate TGF-beta signaling further expands its potential use in cancer research and tissue engineering studies.</p>

<p>Rabbit Polyclonal Ezrin antibody (Thr566)</p>

<p>Anti-Feline Leukemia Virus antibody</p>

<p>Rabbit polyclonal PNCK antibody</p>

<p>Rabbit Polyclonal NMDAR1 antibody (Ser897)</p>

<p>TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC</p>

<p>Purified Rabbit polyclonal MKK7t antibody</p>

<p>The Fibronectin antibody is a monoclonal antibody that specifically targets fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin plays a crucial role in cell adhesion, migration, and tissue repair. This antibody can be used for various applications, including research and diagnostic purposes.</p>

<p>The ATF2 antibody is a potent diagnostic agent used in Life Sciences research. This polyclonal antibody specifically targets the amino-terminal region of ATF2, a transcription factor that plays a crucial role in regulating gene expression. By binding to ATF2, this antibody inhibits its activity and can be used to study the downstream effects of ATF2 inhibition.</p>

<p>Rabbit polyclonal ARMX3 antibody</p>

<p>DVL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPP</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The p53 antibody is a protein that specifically targets and binds to the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP</p>

<p>Purified Rabbit polyclonal TR beta antibody (Ser142)</p>

<p>PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK</p>

<p>Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA</p>

<p>Rabbit Polyclonal HDAC8 antibody (Ser39)</p>

<p>Rabbit polyclonal NFKP p105/p50 antibody</p>

<p>IER5L antibody was raised using the middle region of IER5L corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA</p>

<p>Rabbit polyclonal GLPK2 antibody</p>

<p>CASR antibody was raised in Rabbit using Human CASR as the immunogen</p>

<p>The AML1 antibody is a neutralizing insulin antibody that targets the growth factor adalimumab. It is a monoclonal antibody that specifically binds to glutamate and has been extensively studied in the field of Life Sciences. This antibody is commonly used in research for its ability to detect and measure various proteins, including rubisco, insulin, TNF-α, natriuretic peptides, and glycoproteins. With its high specificity and sensitivity, the AML1 antibody is an essential tool for scientists conducting experiments related to protein analysis and characterization.</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>The IL8 antibody is a polyclonal antibody used in the field of life sciences. It specifically targets alpha-fetoprotein and is known for its neutralizing properties. This antibody is commonly used in research and diagnostic applications. It has been extensively studied and proven to be effective in blocking the activity of TGF-beta, a growth factor involved in various cellular processes. The IL8 antibody is available as a monoclonal antibody and contains excipients to ensure stability and effectiveness. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is highly specific to its target molecule and has been validated for its accuracy and reliability. Researchers rely on the IL8 antibody to study the role of alpha-fetoprotein in different biological systems and to develop potential therapeutic interventions. With its high affinity and specificity, this monoclonal antibody is an essential tool for studying cell signaling pathways, drug discovery, and understanding disease mechanisms.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting strong bactericidal activity. Through transcription-quantitative polymerase chain techniques, its high frequency of human activity has been verified. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified Polyclonal BCAS2 antibody</p>

<p>NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP</p>

<p>Rabbit polyclonal GJB7 antibody</p>

<p>The Tau antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has the ability to neutralize interferon and collagen, making it an essential component in the field of Life Sciences. This antibody is available both as polyclonal antibodies derived from human serum and as monoclonal antibodies.</p>

<p>The SirT1 antibody is a highly specialized tool used in life sciences research. It is a polyclonal antibody that specifically targets the Sirtuin 1 (SirT1) protein, which plays a crucial role in various cellular processes. This antibody can be used in a wide range of applications, including western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Rabbit polyclonal GPR153 antibody</p>

<p>Rabbit polyclonal HORM1 antibody</p>

<p>DHRS2 antibody was raised in Rabbit using Human DHRS2 as the immunogen</p>

<p>Purified Polyclonal IL37 antibody</p>

<p>COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK</p>

<p>Rabbit polyclonal SGK3 antibody</p>

<p>Rabbit polyclonal CARD10 antibody</p>

<p>Rabbit polyclonal RPL17 antibody</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF</p>

<p>LTK antibody was raised in rabbit using the N terminal of LTK as the immunogen</p>

<p>C4ORF22 antibody was raised using the N terminal Of C4Orf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT</p>

<p>Rabbit Polyclonal ATP5L2 antibody</p>

<p>The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.</p>

<p>SRBD1 antibody was raised using the N terminal of SRBD1 corresponding to a region with amino acids MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS</p>

<p>Mouse monoclonal FZE3 antibody</p>

<p>Purified Rabbit polyclonal OSGEPL1 antibody</p>

<p>HMBS antibody was raised using the middle region of HMBS corresponding to a region with amino acids SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR</p>

<p>AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE</p>

<p>Rabbit polyclonal Spermidine synthase antibody (HRP)</p>

<p>Purified Rabbit polyclonal OR13F1 antibody</p>

<p>Rabbit polyclonal MOL1A antibody</p>

<p>The HSP27 antibody is a highly specialized product used in the field of life sciences. It is an activated growth factor that plays a crucial role in various cellular processes. This antibody specifically targets HSP27, a protein involved in the regulation of cell growth and survival.</p>

<p>Rabbit polyclonal AIFM1 antibody</p>

<p>The PRRX1 antibody is a polyclonal antibody that targets the adeno-associated virus (AAV) and its intermediates. It is specifically designed to detect and bind to autoantibodies in nuclear cells, particularly those found in isolated retinal tissues. This antibody can be used as a test compound in various research applications, including the development of anti-thrombotic medicines and other therapeutic interventions. With its solubilized formulation, the PRRX1 antibody offers high specificity and sensitivity, making it an invaluable tool in life sciences research.</p>

<p>The Resistin antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of nuclear antibodies and acts as a growth factor and necrosis factor-related apoptosis-inducing protein complex. This monoclonal antibody is specifically designed to neutralize the effects of resistin, a hormone that plays a role in insulin resistance and inflammation.</p>

<p>Purified Polyclonal MGCRACGAP antibody</p>

<p>Rabbit Polyclonal PPP1R2 antibody (Ser120+Ser121)</p>

<p>Rabbit polyclonal RRAS antibody</p>

<p>RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids  DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM</p>

<p>MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY</p>

<p>ICA1L antibody was raised using the middle region of ICA1L corresponding to a region with amino acids PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA</p>

<p>CD19 antibody was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL</p>

<p>Purified Rabbit polyclonal PRKCG antibody</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>FBLN5 antibody was raised in Rabbit using Human FBLN5 as the immunogen</p>

<p>Mouse monoclonal BCAR1 antibody</p>

<p>Rabbit polyclonal SREBP1 antibody (Ser439)</p>

<p>The CD71 antibody is a powerful tool in the field of Life Sciences. This steroid-based antibody specifically targets the CD71 molecule, also known as transferrin receptor 1. It plays a crucial role in iron metabolism and is highly expressed on the surface of proliferating cells.</p>

<p>The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>Rabbit polyclonal OR8K1 antibody</p>

<p>MAST1 antibody was raised in Rabbit using Human MAST1 as the immunogen</p>

<p>The VASP antibody is a polyclonal antibody that specifically targets and binds to the VASP protein. VASP, also known as vasodilator-stimulated phosphoprotein, plays a crucial role in cell signaling pathways and cytoskeletal rearrangement. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Purified Polyclonal CDYL2 antibody</p>

<p>The Cadherin 6 antibody is a monoclonal antibody that specifically targets the plasminogen receptor. It is commonly used in life sciences research for various applications. This antibody has high affinity and specificity for its target, making it an ideal tool for studying the function of Cadherin 6.</p>

<p>ST14 antibody is a monoclonal antibody that targets protein kinase ST14. It is widely used in Life Sciences research for its ability to specifically bind to ST14 and inhibit its activity. This antibody has been shown to effectively block the function of ST14, preventing its interaction with other proteins and interfering with various cellular processes. Additionally, ST14 antibody has been used in studies involving albumin, inhibitors, antibodies, tyrosine, alpha-synuclein, activated mitogen-activated protein (MAP) kinases, collagen, and glucose transporter. It is also known to enhance the cytotoxic effects of certain anti-CD20 antibodies. With its high specificity and potency, ST14 antibody is a valuable tool for scientists studying protein kinase signaling pathways and their role in disease development and progression.</p>

<p>Rabbit polyclonal NDUFA3 antibody</p>

<p>Ssr2 antibody was raised in rabbit using the C terminal of Ssr2 as the immunogen</p>

<p>RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG</p>

<p>NCOR1 antibody was raised in rabbit using the N terminal of NCOR1 as the immunogen</p>

<p>Ebf3 antibody was raised in rabbit using the N terminal of Ebf3 as the immunogen</p>

<p>FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV</p>

<p>The RB1 antibody is a highly specialized monoclonal antibody that targets glycan dimers. It specifically recognizes and binds to the glycopeptide region of these dimers, which plays a crucial role in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the activity of chemokines, including TNF-α.</p>

<p>Rabbit polyclonal SLC12A4 antibody</p>

<p>Cacng1 antibody was raised in rabbit using the middle region of Cacng1 as the immunogen</p>

<p>Rabbit polyclonal WRN antibody (Ser1141)</p>

<p>EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen</p>

<p>Rabbit polyclonal cJun antibody (Ser63)</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>C7ORF38 antibody was raised using the middle region of C7Orf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS</p>

<p>Purified Polyclonal Fibulin 4 antibody</p>

<p>The RAD9 antibody is a trifunctional antibody that plays a crucial role in various life sciences applications. It is widely used in research to study the signaling pathways of growth factors and 3-kinase enzymes. This polyclonal antibody specifically targets the RAD9 protein, which is activated in response to genotoxic stress and DNA damage. It has been shown to have neutralizing effects on amyloid proteins and can be used to detect and quantify alpha-fetoprotein levels in human serum samples. The RAD9 antibody is also commonly utilized in immunohistochemistry and Western blotting techniques, making it an essential tool for researchers studying protein kinases, chemokines, and other molecular markers. With its high specificity and sensitivity, this antibody provides reliable results for a wide range of experimental applications in the field of Life Sciences.</p>

<p>Rabbit polyclonal OR2T11 antibody</p>

<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE</p>

<p>Purified Polyclonal GSK3 alpha/beta antibody</p>

<p>LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF</p>