Anticuerpos primarios

<p>Rabbit polyclonal HIV1-RT antibody (FITC)</p>

<p>Dilantin antibody was raised in goat using phenytoin-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>The Influenza A antibody is a monoclonal antibody that specifically targets the amino group of the influenza virus. This antibody is derived from trastuzumab, a widely used therapeutic antibody in the field of Life Sciences. The Influenza A antibody can be used in various applications such as immunoassays, western blotting, and immunohistochemistry.</p>

<p>hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.</p>

<p>Polyclonal SIV mac251 gp28 antibody (biotin)</p>

<p>HIV1-RT antibody (FITC) was raised in mouse using purified, full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Goat polyclonal PF4 antibody</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Rabbit anti Chicken IgY antibody</p>

<p>Estradiol antibody was raised in goat using 17 beta estradiol-3-BSA as the immunogen.</p>

<p>Rabbit polyclonal HIV1 IIIB protease antibody (FITC)</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Goat polyclonal Human  Complement 3D antibody</p>

<p>HIV1 Nef antibody was raised in mouse using full length nef (HIV-1, ELI) as the immunogen.</p>

<p>Morphine 3 antibody was raised in goat using 3-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>Progesterone 11 antibody was raised in rabbit using Progesterone-11-HSA as the immunogen.</p>

<p>Goat polyclonal Human ApoB antibody</p>

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>Triiodothyronine antibody was raised in rabbit using triiodothyronine (T3)-BSA as the immunogen.</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 50 ug/vial; clone 4</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>Mouse monoclonal HIV1 tat antibody (biotin)</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Rabbit polyclonal Cystatin C antibody</p>

<p>Luteinizing hormone beta antibody was raised in goat using human LH beta as the immunogen.</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Furosemide antibody was raised in rabbit using furosemide-KLH as the immunogen.</p>

<p>FSH antibody was raised in mouse using highly purified FSH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>HSV1 gC antibody was raised in mouse using herpes simplex virus gC-1 as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Vitamin A antibody was raised in rabbit using vitamin A as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>

<p>Goat polyclonal Human BNP antibody</p>

<p>Tobramycin antibody was raised in goat using tobramycin-BSA as the immunogen.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>

<p>HIV1 tat antibody was raised in sheep using glutathione-S-transferase (GST) fusion protein (E. coli) as the immunogen.</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>THC antibody was raised in goat using delta-6-Tetrahydrocannabinol-KLH as the immunogen.</p>

<p>hCG Alpha antibody was raised in goat using Alpha subunit of HCG as the immunogen.</p>

<p>Progesterone antibody was raised in rabbit using 17a-OH progesterone -3-CMO-BSA as the immunogen.</p>

<p>Rabbit anti-guinea pig IgG (H+L) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Anti-Human CGRP Monoclonal Antibody</p>

<p>Human IgG1 anti-CD52 monoclonal antibody</p>

<p>Anti-Human VISTA Monoclonal Antibody</p>

<p>C Peptide antibody was raised in guinea pig using synthetic human C-Peptide as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Trypsin antibody was raised in rabbit using human pancreatic trypsin as the immunogen.</p>

<p>Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.</p>

<p>HIV1 tat antibody was raised in rabbit using purified, full length recombinant TAT (HIV-1) as the immunogen.</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Mouse monoclonal HIV2 p26 antibody (biotin)</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>Goat anti Human IgE antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>Rabbit polyclonal GDI2 antibody (biotin)</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>DYRK1B antibody was raised in Rabbit using Human DYRK1B as the immunogen</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>