Anticuerpos primarios

<p>Polyclonal Myoglobin antibody</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Rabbit polyclonal HIV1 Rev antibody (biotin)</p>

<p>Furosemide antibody was raised in rabbit using furosemide-KLH as the immunogen.</p>

<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>

<p>The HIV1 tat antibody is a protein that belongs to the oncostatin and natriuretic family. It acts as a kinase inhibitor and is available as both a monoclonal antibody and polyclonal antibodies in the field of Life Sciences. This antibody specifically targets the tat protein of HIV-1, which plays a crucial role in viral replication and immune evasion. By binding to the tat protein, this antibody inhibits its function and prevents viral replication.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.</p>

<p>Measles virus nucleoprotein antibody was raised in goat using full length recombinant measles virus nucleoprotein produced in baculovirus expression system as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Goat polyclonal HIV1 antibody</p>

<p>Rabbit polyclonal SIV mac251 gp120 antibody (FITC); full SIV1 mac251 gp120 immunogen</p>

<p>Goat polyclonal Human Cystatin C antibody</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Goat anti-rat IgG was raised in goat using highly pure rat IgG as the immunogen.</p>

<p>Goat anti Human IgA + IgD antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>

<p>Rabbit Polyclonal HIV1 protease antibody; 1mg/ml; Supplied in frozen form.</p>

<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Digitoxigenin antibody was raised in goat using digitoxigenin as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>PTH antibody was raised in rabbit using hPTH as the immunogen.</p>

<p>Vitamin A antibody was raised in rabbit using vitamin A as the immunogen.</p>

<p>ApoA-II antibody was raised in goat using highly purified human APO A-II as the immunogen.</p>

<p>HIV1 tat antibody was raised in rabbit using purified, full length recombinant TAT (HIV-1) as the immunogen.</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>Digoxin antibody was raised in rabbit using digoxin-BSA as the immunogen.</p>

<p>Goat polyclonal FABP antibody</p>

<p>FABP antibody was raised in goat using purifed FABP from human heart tissue as the immunogen.</p>

<p>CKBB antibody was raised in rabbit using human CKBB from the brain as the immunogen.</p>

<p>PAP antibody was raised in goat using human PAP as the immunogen.</p>

<p>Cocaine antibody was raised in goat using cocaine-KLH as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in rabbit using LH beta-KLH as the immunogen.</p>

<p>hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.</p>

<p>Trypsin antibody was raised in rabbit using human pancreatic trypsin as the immunogen.</p>

<p>This polyclonal antibody product: affinity purified Sheep Anti-HIV-1-gp120 was produced by first immunizing sheep with a single synthetic peptide which has the amino acid sequence: APTKAKRRVVQREKR. This amino acid sequence corresponds to amino acid section 497-511 in the envelope gene gp120 protein of the BH-10 strain of HIV-1. The antibodies are then isolated from the sheep hyperimmune serum by affinity chromatography using the APTKAKRRVVQREKR sequenced synthetic peptide coupled to Sepharose. The serological activity of the antibodies is checked by ELISA and lyophilized in PBS. 0.15M NaCl (pH 7.4) without preservative.<br>The glycoprotein gp120 is an essential Human Immunodeficiency virus (HIV) envelope subunit which facilitates the entry of the HIV into CD4 T cells through binding to CD4 receptors and CCR5 or CXCR4 chemokine co-receptors on host cells. This attachment enables the second key envelope glycoprotein gp41 to form a six-helix bundle and therefore fuse to the host cell membrane. This HIV gp120 complementary antibody can be used to detect the presence of the HIV gp120 subunit in antigen detection assays such as ELISA, automated immunoassays, western blot and lateral flow.</p>

<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Mouse monoclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>HIV1 integrase antibody was raised in mouse using full length recombinant Integrase (HIV-1, IIIB) as the immunogen.</p>

<p>HIV1 tat antibody was raised in sheep using glutathione-S-transferase (GST) fusion protein (E. coli) as the immunogen.</p>

<p>Tobramycin antibody was raised in goat using tobramycin-BSA as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Mouse monoclonal HIV2 p26 antibody (biotin)</p>

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>hCG antibody was raised in rabbit using hCG beta as the immunogen.</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Estriol 6 antibody was raised in rabbit using estriol-6-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer</p>

<p>Mouse monoclonal HIV1 tat antibody (biotin)</p>

<p>Thyroxine antibody is a highly reactive collagen-based monoclonal antibody used in Life Sciences research. It is commonly used for the detection and quantification of thyroxine levels in human serum samples. This antibody specifically targets and binds to thyroxine, preventing its interaction with other molecules. The immobilization of this antibody on an electrode surface allows for efficient and sensitive detection of thyroxine levels. Additionally, studies have shown that this antibody has neutralizing effects on interleukin-6, a pro-inflammatory cytokine involved in various diseases. Furthermore, it has been observed that the binding of this antibody to thyroxine can inhibit the production of reactive oxygen species, making it potentially useful in antioxidant therapies.</p>

<p>Mouse monoclonal HIV-1 antibody; IgG2b</p>

<p>Mouse monoclonal HIV1-RT antibody (HRP)</p>

<p>Rabbit polyclonal HIV1-RT antibody (FITC)</p>

<p>Epitestosterone antibody was raised in rabbit using protein-3-oxime-epitestosterone conjugate as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Human IgG1 anti-CD52 monoclonal antibody</p>

<p>Triiodothyronine antibody was raised in rabbit using triiodothyronine (T3)-BSA as the immunogen.</p>

<p>AFP antibody was raised in rabbit using human AFP as the immunogen.</p>

<p>Donkey anti-goat IgG was raised in donkey using highly pure goat IgG as the immunogen.</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>DYRK1B antibody was raised in Rabbit using Human DYRK1B as the immunogen</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>