Anticuerpos primarios

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>Triiodothyronine antibody was raised in rabbit using triiodothyronine (T3)-BSA as the immunogen.</p>

<p>Androstenedione antibody was raised in rabbit using androstenedione-19 as the immunogen.</p>

<p>Goat polyclonal Human AFP antibody</p>

<p>A chimeric human/macaque IgG1 anti-CD4 monoclonal antibody</p>

<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Androstenedione antibody was raised in rabbit using 4-androstene 3, 17-dione-11-protein conjugate as the immunogen.</p>

<p>C Peptide antibody was raised in guinea pig using synthetic human C-Peptide as the immunogen.</p>

<p>Rabbit polyclonal BNP antibody</p>

<p>Rabbit polyclonal HIV1 IIIB protease antibody (FITC)</p>

<p>Goat polyclonal Human Complement C1s antibody</p>

<p>Rabbit polyclonal HIV1-RT antibody (FITC)</p>

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Goat polyclonal FABP antibody</p>

<p>Goat polyclonal Human ApoB antibody</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Goat polyclonal Cystatin C antibody</p>

<p>PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.</p>

<p>Goat polyclonal Human BNP antibody</p>

<p>Luteinizing hormone antibody was raised in goat using human pituitary LH as the immunogen.</p>

<p>HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Mouse monoclonal CD4 (T-cell receptor) antibody (FITC)</p>

<p>The hCG beta antibody is a monoclonal antibody that specifically targets and neutralizes the human chorionic gonadotropin (hCG) beta subunit. This antibody is known to form dimers, which enhance its binding affinity and neutralizing activity against hCG. It has been widely used in life sciences research to study the role of hCG in various biological processes.</p>

<p>HIV1 p24 antibody (IgG purified) was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>

<p>Goat polyclonal CRP antibody</p>

<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>

<p>Mouse monoclonal HSV2 gD antibody</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>HIV1 gp120 antibody (FITC) was raised in rabbit using full length recombinant gp120 (HIV-1) expressed in baculovirus expression system as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>The ST2 antibody is a monoclonal antibody that has neutralizing properties against amyloid plaque. It works by binding to dopamine growth factor, which is present in human serum. This antibody is widely used in the field of life sciences for research purposes. Additionally, it has shown potential as an antiviral medicament due to its ability to inhibit the replication of certain viruses. The ST2 antibody can be used in various applications, including immunoassays and diagnostic tests. Its high specificity and affinity make it a valuable tool for studying alpha-fetoprotein and other biomarkers. With its carbon electrode technology, this monoclonal antibody offers enhanced sensitivity and accuracy in detecting target molecules.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Mouse monoclonal REV (HIV-1 HxB2, HxB3) antibody (FITC)</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer</p>

<p>Rabbit anti-guinea pig IgG (H+L) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC); immunogen HIV gp41; IgG1</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Goat anti Human IgG Fc + IgD antibody</p>

<p>Aldosterone-3 antibody was raised in rabbit using aldosterone-3-BSA as the immunogen.</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Cortisol 3 antibody was raised in mouse using cortisol-3-BSA as the immunogen.</p>

<p>HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.</p>

<p>Goat polyclonal Human Properdin antibody</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Mouse monoclonal HIV1-RT antibody (biotin)</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>Ferritin antibody was raised in rabbit using human liver ferritin as the immunogen.</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV) produced in baculovirus as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp26 antibody</p>

<p>Sheep polyclonal HIV1 p24 antibody (FITC)</p>

<p>HIV1 p24 antibody (biotin) was raised in mouse using purified full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (biotin)</p>

<p>Rabbit polyclonal Cystatin C antibody</p>

<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>

<p>Rabbit polyclonal SIV mac251 gp120 antibody (FITC); full SIV1 mac251 gp120 immunogen</p>

<p>Goat anti Human IgM antibody</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>HIV2 p26 antibody was raised in mouse using purified, full length recombinant p26 (HIV-2 ROD) produced in E. coli expression system as the immunogen.</p>

<p>Rabbit anti Chicken IgY antibody</p>

<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.</p>

<p>Goat polyclonal Human Alpha 1 Antichymotrypsin antibody</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>Goat polyclonal Human  Complement 3D antibody</p>

<p>CEA antibody was raised in goat using human CEA as the immunogen.</p>

<p>human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.</p>

<p>HSV2 gD antibody was raised in mouse using herpes simplex virus 2 glycoprotein D (gD) as the immunogen.</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Goat anti Human IgE antibody</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Calibrator for Cat ELISA Kit</p>