Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.609 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.394 productos)
- Anticuerpos del metabolismo(278 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 75081 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ece2 antibody
<p>Ece2 antibody was raised in rabbit using the middle region of Ece2 as the immunogen</p>Pureza:Min. 95%ARID5A antibody
<p>ARID5A antibody was raised in rabbit using the N terminal of ARID5A as the immunogen</p>Pureza:Min. 95%KIAA1754L antibody
<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA</p>Pureza:Min. 95%RAB38 antibody
<p>RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV</p>Pureza:Min. 95%CD24 antibody (biotin)
<p>CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molSPPL2B antibody
<p>SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL</p>Pureza:Min. 95%SOCS1 antibody
<p>SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA</p>Pureza:Min. 95%CASP5 antibody
<p>CASP5 antibody was raised in rabbit using the middle region of CASP5 as the immunogen</p>Pureza:Min. 95%Snap29 antibody
<p>Snap29 antibody was raised in rabbit using the middle region of Snap29 as the immunogen</p>Pureza:Min. 95%ADAM7 antibody
<p>ADAM7 antibody was raised using the C terminal of ADAM7 corresponding to a region with amino acids PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK</p>Pureza:Min. 95%Chymotrypsinogen B1 antibody
<p>Chymotrypsinogen B1 antibody was raised using the N terminal of CTRB1 corresponding to a region with amino acids MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS</p>Pureza:Min. 95%E. coli O157 antibody (FITC)
<p>E. coli O157 antibody (FITC) was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.</p>UGT1A6 antibody
<p>UGT1A6 antibody was raised using the C terminal of UGT1A6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK</p>Pureza:Min. 95%CD45.2 antibody (PE-CY5.5)
<p>CD45.2 antibody (PE) was raised in mouse using CD45.2 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molListeria antibody
<p>The Listeria antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential applications in various research areas. This antibody specifically targets Listeria, a bacterium known to cause foodborne illnesses.</p>Pureza:Min. 95%ZNF597 antibody
<p>ZNF597 antibody was raised in rabbit using the middle region of ZNF597 as the immunogen</p>Pureza:Min. 95%CD45R antibody (Spectral Red)
<p>CD45R antibody (biotin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD25 antibody (biotin)
<p>CD25 antibody (biotin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molZNF131 antibody
<p>ZNF131 antibody was raised in rabbit using the middle region of ZNF131 as the immunogen</p>Pureza:Min. 95%SLC7A1 antibody
<p>SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNA</p>Pureza:Min. 95%BRSV antibody
<p>BRSV antibody was raised in rabbit using residues 201-211 [KELLPKVNNHDC] of the 63 kDa BRSV F protein as the immunogen.</p>Pureza:Min. 95%ST3GAL2 antibody
<p>ST3GAL2 antibody was raised using the C terminal of ST3GAL2 corresponding to a region with amino acids ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN</p>Pureza:Min. 95%PLP1 antibody
<p>PLP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL</p>Pureza:Min. 95%POLK antibody
<p>POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL</p>Pureza:Min. 95%Annexin A10 antibody
<p>Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE</p>Pureza:Min. 95%HOM-TES-103 antibody
<p>HOM-TES-103 antibody was raised in rabbit using the C terminal of HOM-TES-103 as the immunogen</p>Pureza:Min. 95%CD25 antibody (Spectral Red)
<p>CD25 antibody (Spectral Red) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molRNF170 antibody
<p>RNF170 antibody was raised using the middle region of RNF170 corresponding to a region with amino acids CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY</p>Pureza:Min. 95%PIK3R4 antibody
<p>PIK3R4 antibody was raised using the N terminal of PIK3R4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL</p>Pureza:Min. 95%ST6GALNAC6 antibody
<p>ST6GALNAC6 antibody was raised in rabbit using the N terminal of ST6GALNAC6 as the immunogen</p>Pureza:Min. 95%CD16 antibody (biotin)
<p>CD16 antibody (biotin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>Pureza:Min. 95%Peso molecular:0 g/molRELM alpha antibody
<p>RELM alpha antibody was raised in rabbit using highly pure recombinant murine RELMa as the immunogen.</p>Pureza:Min. 95%CD3e antibody (Allophycocyanin)
<p>CD3e antibody (Allophycocyanin) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCXorf9 antibody
<p>CXorf9 antibody was raised in rabbit using the C terminal of CXorf9 as the immunogen</p>Pureza:Min. 95%CD163 antibody (biotin)
<p>CD163 antibody (biotin) was raised in mouse using human monocytes as the immunogen.</p>LAX1 antibody
<p>LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS</p>Pureza:Min. 95%Tetraspanin 31 antibody
<p>Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR</p>Pureza:Min. 95%CD45RB antibody (Spectral Red)
<p>CD45RB antibody (biotin) was raised in rat using cloned murine Th2 cell lines as the immunogen.</p>CD11b antibody (Spectral Red)
<p>CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD3e antibody (FITC)
<p>CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molJAZF1 antibody
<p>JAZF1 antibody was raised in rabbit using the N terminal of JAZF1 as the immunogen</p>Pureza:Min. 95%SLC39A4 antibody
<p>SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQCLSVEDALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCE</p>Pureza:Min. 95%IGF BP3 antibody
<p>IGF BP3 antibody was raised in rabbit using highly pure recombinant human IGF-BP3 as the immunogen.</p>Pureza:Min. 95%CD45RC antibody (FITC)
<p>CD45 antibody (FITC) was raised in Rat using as exon C-dependent epitope of CD45 glycoprotin as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molFAM82C antibody
<p>FAM82C antibody was raised using the middle region of Fam82C corresponding to a region with amino acids LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA</p>Pureza:Min. 95%ZNF596 antibody
<p>ZNF596 antibody was raised in rabbit using the C terminal of ZNF596 as the immunogen</p>Pureza:Min. 95%PITPNM1 antibody
<p>PITPNM1 antibody was raised in rabbit using the N terminal of PITPNM1 as the immunogen</p>Pureza:Min. 95%CD38 antibody (FITC)
<p>CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/molCD28 antibody (FITC)
<p>CD28 antibody (FITC) was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>Pureza:Min. 95%Peso molecular:0 g/mol
