Anticuerpos primarios

<p>Retinal S antigen Monoclonal Antibody</p>

<p>Rabbit polyclonal PSMD5 antibody</p>

<p>Mouse monoclonal AMACR antibody (C-terminus)</p>

<p>The CD8 antibody is a monoclonal antibody that plays a crucial role in the immune response. It specifically targets the CD8 protein, which is found on the surface of cytotoxic T cells. This antibody can be used in various life science applications, such as immunoassays and antigen-antibody reactions.</p>

<p>CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD</p>

<p>NUDT16L1 antibody was raised in rabbit using the middle region of NUDT16L1 as the immunogen</p>

<p>FABP1 antibody was raised in mouse using recombinant human FABP1 (1-127aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>ZNF660 antibody was raised in rabbit using the N terminal of ZNF660 as the immunogen</p>

<p>The GHRH Receptor antibody is a specific antibody that targets the growth hormone-releasing hormone (GHRH) receptor. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown to have neutralizing effects on the GHRH receptor, inhibiting its activity and downstream signaling pathways.</p>

<p>NCOA1 antibody was raised in Rabbit using Human NCOA1 as the immunogen</p>

<p>The CRYAB antibody is a highly specialized monoclonal antibody that targets collagen and other binding proteins. It is commonly used in the field of Life Sciences for various applications. This monoclonal antibody has the unique ability to neutralize reactive and activated growth factors, making it an essential tool for researchers studying cell signaling pathways and protein interactions. Additionally, the CRYAB antibody has demonstrated cytotoxic effects on specific cell types, further expanding its potential applications in cancer research. With its high specificity and affinity, this monoclonal antibody can be easily purified using chromatographic techniques, ensuring optimal performance in experiments. Whether you're investigating hepatocyte growth or glycoprotein function, the CRYAB antibody is a valuable asset that will enhance your research outcomes.</p>

<p>Mouse monoclonal PRPS1 antibody</p>

<p>SMC2 antibody was raised using the N terminal of SMC2 corresponding to a region with amino acids ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE</p>

<p>IL18 antibody was raised in rabbit using the C terminal of IL18 as the immunogen</p>

<p>MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP</p>

<p>Hepatitis B Virus PreS2 antibody was raised in rabbit using residues 132-145 [CQDPRVRGLYFPAGG] of the 42 kDa preS2 HBV protein as the immunogen.</p>

<p>Rabbit polyclonal ELAV2/4 antibody</p>

<p>Rabbit polyclonal NELFA antibody</p>

<p>NARG1L antibody was raised using the middle region of NARG1L corresponding to a region with amino acids ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA</p>

<p>The PACAP antibody is a proteolytic monoclonal antibody that targets the cyclase-activating peptide (PACAP). It has been shown to exhibit cell cytotoxicity by binding to the conformational epitope of PACAP. This antibody can be used in various applications in the field of Life Sciences, including research on growth factors and as a vaccine adjuvant composition. The PACAP antibody specifically recognizes and binds to PACAP, which is involved in numerous biological processes such as glutamate release and regulation of hormone secretion. Additionally, this antibody has been used in hybridization studies to investigate the expression pattern of PACAP in different tissues. Its ability to modulate cyclase activation makes it a valuable tool for studying signaling pathways mediated by PACAP and its interaction with other molecules such as epidermal growth factor.</p>

<p>SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR</p>

<p>Rabbit polyclonal SEPHS1 antibody</p>

<p>Rabbit polyclonal RBP4 antibody (HRP)</p>

<p>Rabbit polyclonal PRKX antibody</p>

<p>Rabbit polyclonal RBL1 antibody</p>

<p>LOH12CR1 antibody was raised in Rabbit using Human LOH12CR1 as the immunogen</p>

<p>SFRS7 antibody was raised using the N terminal of SFRS7 corresponding to a region with amino acids MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA</p>

<p>Affinity purified Rabbit polyclonal CLN2 antibody</p>

<p>CD45 antibody was raised in mouse using human CD45 as the immunogen.</p>

<p>Rabbit polyclonal SHC antibody (Tyr427)</p>

<p>Rabbit polyclonal C21orf33 antibody</p>

<p>The Cdc27 Antibody is a highly specialized product in the field of Life Sciences. It is a Monoclonal Antibody that targets TNF-α, interferon, and anti-DNP antibodies. This antibody has the ability to induce lysis and neutralize globulin. Additionally, it has antiangiogenic properties and inhibits endothelial growth factor. The Cdc27 Antibody is also cytotoxic and can activate caspase-9, which plays a crucial role in apoptosis. With its wide range of applications and potent effects, this antibody is an essential tool for researchers in various fields of study.</p>

<p>RNF31 antibody was raised using the middle region of RNF31 corresponding to a region with amino acids SLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKL</p>

<p>The TMEFF2 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for research purposes. This antibody specifically targets TMEFF2, which is an antigen involved in various biological processes.</p>

<p>Rabbit polyclonal Osteopontin antibody (HRP)</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>PSMC3IP antibody was raised in rabbit using the C terminal of PSMC3IP as the immunogen</p>

<p>POLR1D antibody was raised in mouse using recombinant Human Polymerase (Rna) I Polypeptide D, 16Kda (Polr1D)</p>

<p>Rat monoclonal CD24 antibody (FITC)</p>

<p>Mouse monoclonal NLN antibody</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a central role in various cellular processes. It's a key player in the PI3K/Akt/mTOR pathway, which is essential for regulating cell growth, survival, metabolism, and proliferation.Structure: Akt has three main isoforms in humans (Akt1, Akt2, and Akt3), each encoded by different genes. Activation: Akt activation is typically initiated by external signals, such as growth factors or insulin, that bind to cell surface receptors. This activates phosphoinositide 3-kinase (PI3K), which then produces phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane. PIP3 then recruits Akt to the membrane where it is activated by two key phosphorylation events at Thr308 and Ser473. Once fully activated, Akt can move to different parts of the cell to phosphorylate its target proteins.The key functions of Akt include:Cell Survival and Anti-Apoptosis: Akt inhibits apoptosis by phosphorylating and inactivating several pro-apoptotic proteins, such as BAD and Caspase-9.Cell Growth and Proliferation: By promoting protein synthesis and inhibiting pathways that would otherwise halt the cell cycle, Akt encourages cell growth. It activates mTOR, a major regulator of protein synthesis and cellular growth.Metabolic Regulation: Akt influences metabolism by increasing glucose uptake and glycolysis, primarily through GLUT4 translocation and hexokinase activation, which is especially important in muscle and adipose tissues.Angiogenesis: Akt can stimulate the growth of new blood vessels by increasing the expression of VEGF (vascular endothelial growth factor), supporting tissue growth and repair.Cell Migration and Invasion: Akt is involved in processes that facilitate cell motility, aiding in wound healing and, unfortunately, in the spread of cancer cells.Given its role in promoting cell survival and growth, Akt is frequently hyperactivated in cancers, leading to uncontrolled cell division and tumor growth. Many cancer therapies target the PI3K/Akt/mTOR pathway to suppress this hyperactivity. Furthermore Akt's role in regulating glucose metabolism links it to insulin signaling. Defects in this pathway can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>Affinity purified Chicken polyclonal 200 kDa Neurofilament antibody</p>

<p>MOMA2 antibody (mouse) was raised in rat using mouse lymph node stroma as the immunogen.</p>

<p>Rabbit polyclonal RAPGEF5 antibody</p>

<p>FAU antibody was raised in Rabbit using Human FAU as the immunogen</p>

<p>The TOM20 antibody is a highly specific monoclonal antibody that targets the TOM20 protein. This protein is an essential component of the translocase of the outer mitochondrial membrane (TOM) complex, which is involved in the import of proteins into mitochondria. The TOM20 antibody has been widely used in research and diagnostic applications in the field of Life Sciences.</p>

<p>Purified Polyclonal RPC antibody</p>

<p>PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA</p>

<p>Purified Polyclonal CD49e LC antibody</p>