Anticuerpos primarios

<p>Purified Polyclonal USP11 antibody</p>

<p>Purified Polyclonal SLU7 antibody</p>

<p>Maspin antibody was raised in mouse using recombinant Maspin (1-375aa) purified from E. coli as the immunogen.</p>

<p>The STAT5A antibody is a highly effective medicament that targets the STAT5A protein, a key player in various cellular processes. This antibody specifically binds to STAT5A and inhibits its activity, leading to a decrease in TGF-beta signaling and reduced microvessel density. The use of this antibody has shown promising results in blocking IL-17A-induced inflammation and has been used as a research tool to study the role of STAT5A in oncogenic kinase signaling pathways. Additionally, this antibody can be used for immunohistochemistry and Western blotting to detect and quantify STAT5A protein levels in cells and tissues. With its high specificity and sensitivity, this monoclonal antibody is an indispensable tool for researchers studying growth factors, messenger RNA regulation, and protein inhibitors.</p>

<p>Rabbit polyclonal ARF5 antibody (biotin)</p>

<p>Mouse monoclonal VWA5A antibody</p>

<p>HA antibody was raised in chicken using haemagglutinin-KLH conjugate as the immunogen.</p>

<p>The DECR1 antibody is a highly specialized peptide agent used in Life Sciences research. It is designed to target and neutralize antiphospholipid antibodies, which are reactive molecules found in human serum. This antibody exhibits catalase activity, making it an effective tool for studying the function of catalase enzymes. Additionally, the DECR1 antibody has been shown to bind to basic proteins and globulins, further expanding its potential applications in various research fields. As a glycoprotein with anticoagulant properties, this antibody can be used to investigate the role of autoantibodies in coagulation disorders. Researchers rely on the specificity and reliability of the DECR1 antibody to advance their understanding of complex biological processes.</p>

<p>TRIB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE</p>

<p>MEIS3 antibody was raised in Rabbit using Human MEIS3 as the immunogen</p>

<p>The SIX2 antibody is a polyclonal antibody that targets the SIX2 protein. It has been shown to be effective in detecting and quantifying the expression of SIX2 in various biological samples. The SIX2 protein is involved in the development and maintenance of several organs, including the kidney, limb, and brain. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis. The SIX2 antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. Its high specificity and sensitivity make it a valuable tool for researchers in the field of life sciences studying organ development and disease mechanisms. Additionally, the SIX2 antibody has potential therapeutic applications as an anti-angiogenic agent or for targeting specific cancer cells expressing high levels of SIX2 protein.</p>

<p>Purified Polyclonal Aquaporin 12A antibody</p>

<p>Rabbit polyclonal PSMD6 antibody</p>

<p>LSM10 antibody was raised in mouse using recombinant Human Lsm10, U7 Small Nuclear Rna Associated (Lsm10)</p>

<p>Rat monoclonal CCR7 antibody (allophycocyanin)</p>

<p>Rabbit Polyclonal CCS antibody</p>

<p>The TCL1 antibody is a monoclonal antibody that targets the TCL1 protein, which is involved in cell growth and survival. This antibody has been shown to inhibit the growth of cancer cells by neutralizing the activity of TCL1. It has also been found to reduce microvessel density, indicating its potential as an anti-angiogenic agent. The TCL1 antibody is widely used in life sciences research to study the role of TCL1 in various cellular processes. It can be used for applications such as immunohistochemistry, western blotting, and flow cytometry. With its high specificity and affinity for TCL1, this antibody is a valuable tool for researchers studying cancer biology and therapeutic development.</p>

<p>The Cytokeratin 8 antibody is a highly specific monoclonal antibody that targets cytokeratin 8, a protein found in epithelial cells. This antibody is widely used in research and clinical applications to study the expression and localization of cytokeratin 8 in various tissues and cell types.</p>

<p>AMPH antibody was raised in Rabbit using Human AMPH as the immunogen</p>

<p>The TIM3 antibody is a monoclonal antibody that specifically targets the TIM3 molecule, which is found in the nucleus of cells. This antibody is widely used in Life Sciences research for various applications. It has been shown to have cytotoxic effects on cells expressing high levels of TIM3, making it a valuable tool for studying its function and potential therapeutic applications. Additionally, the TIM3 antibody has been used in studies related to thrombocytopenia, anti-icos antibodies, anti-mesothelin antibodies, urokinase plasminogen activator, and β-catenin. Its high specificity and affinity make it an essential component in many research projects within the field of molecular biology and immunology.</p>

<p>Rabbit polyclonal FABP antibody (Cardiac) (HRP)</p>

<p>Rabbit polyclonal ZBTB7A antibody</p>

<p>NR4A1 antibody was raised in mouse using recombinant Human Nuclear Receptor Subfamily 4, Group A, Member 1 (Nr4A1)</p>

<p>CD69 antibody (Azide free) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.</p>

<p>DMPK antibody was raised using the middle region of DMPK corresponding to a region with amino acids TRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVED</p>

<p>The RECQL4 antibody is a highly specialized receptor-binding agent that is used in various applications within the field of Life Sciences. It is commonly employed in research and bioassays to study cellular processes and investigate the role of RECQL4 in different biological systems. This antibody specifically targets RECQL4, an important protein involved in DNA repair and maintenance.</p>

<p>The Parkin antibody is a highly specific and potent antibody that plays a crucial role in the field of Life Sciences. This antibody is widely used for various applications, including molecular interaction studies, growth factor research, and biomolecule analysis. It has been extensively tested and validated to ensure its high quality and reliability.</p>

<p>PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR</p>

<p>The IGF2BP3 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of monoclonal antibodies and has shown great potential as an antiviral agent. This antibody specifically targets insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3), a key regulator of cell growth and proliferation.</p>

<p>GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, hindering transcription and replication processes.</p>

<p>Rabbit polyclonal Annexin A2 antibody (HRP)</p>

<p>Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK</p>

<p>The LAT antibody is a neuroprotective agent that specifically targets catecholaminergic neurons. It has been extensively studied in the field of Life Sciences for its ability to activate and protect these neurons. The LAT antibody has shown to have a positive effect on cholinergic function and can enhance the production of interleukin-6, a growth factor involved in neuronal survival and regeneration. This antibody is produced by a hybridoma cell line and contains specific amino acid residues that allow it to bind to dopamine receptors. In addition, the LAT antibody has been found to have cytotoxic effects on certain cancer cells and can inhibit the activity of kinase substrates. It is commonly used in research laboratories and pharmaceutical companies for various applications related to neuroscience and immunology.</p>

<p>FZD7 antibody was raised in Rabbit using Human FZD7 as the immunogen</p>

<p>TNF alpha antibody is a monoclonal antibody that specifically targets TNF alpha, a protein involved in inflammation and immune response. This antibody is designed to bind to TNF alpha and inhibit its activity. It is composed of amino acid residues that are carefully selected to ensure high specificity and affinity for the target protein. TNF alpha antibody is a glycoprotein that has been activated and optimized for therapeutic use. Monoclonal antibodies like this one have been extensively researched and developed as potential cytotoxic inhibitors of TNF alpha. They have shown promising results in preclinical studies and are currently being evaluated in clinical trials for various inflammatory conditions. TNF alpha antibody can be used in research assays and also holds potential applications in the field of life sciences.</p>

<p>THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND</p>

<p>SFT2D3 antibody was raised in rabbit using the N terminal of SFT2D3 as the immunogen</p>

<p>Rabbit polyclonal SP1 antibody (Thr739)</p>

<p>The ZAP70 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and inhibits the growth factor erythropoietin receptor (EpoR). By blocking this receptor, the ZAP70 antibody acts as an anti-VEGF (vascular endothelial growth factor) and antiangiogenic agent, preventing the formation of new blood vessels.</p>

<p>Affinity purified Rabbit polyclonal CBFA2T2 antibody</p>

<p>HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH</p>

<p>The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>MKRN2 antibody was raised using the N terminal of MKRN2 corresponding to a region with amino acids STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC</p>

<p>Rat monoclonal CD49d antibody (biotin)</p>

<p>Mouse monoclonal ZFAND2B antibody</p>

<p>CD25 antibody was raised in mouse using Stimulated PBMC as the immunogen.</p>

<p>ACTL7A antibody was raised in Rabbit using Human ACTL7A as the immunogen</p>

<p>RPL37 antibody was raised in rabbit using the middle region of RPL37 as the immunogen</p>

<p>MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM</p>