Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.609 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.691 productos)
- Anticuerpos del metabolismo(278 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
SLC5A9 antibody
<p>SLC5A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA</p>Pureza:Min. 95%Annexin A4 antibody
<p>Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL</p>Pureza:Min. 95%RAB18 antibody
<p>RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG</p>Pureza:Min. 95%AWAT1 antibody
<p>AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids LLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVC</p>Pureza:Min. 95%BRF2 antibody
<p>BRF2 antibody was raised in rabbit using the N terminal of BRF2 as the immunogen</p>Pureza:Min. 95%TMCC3 antibody
<p>TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL</p>Pureza:Min. 95%TBCB antibody
<p>TBCB antibody was raised in rabbit using the N terminal of Tbcb as the immunogen</p>Pureza:Min. 95%PRKAA1 antibody
<p>PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH</p>Pureza:Min. 95%RAB37 antibody
<p>RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogen</p>Pureza:Min. 95%SCUBE2 antibody
<p>SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG</p>Pureza:Min. 95%RIOK3 antibody
<p>RIOK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLA</p>Pureza:Min. 95%GOSR1 antibody
<p>GOSR1 antibody was raised in rabbit using the C terminal of GOSR1 as the immunogen</p>Pureza:Min. 95%ZBTB26 antibody
<p>ZBTB26 antibody was raised in rabbit using the C terminal of ZBTB26 as the immunogen</p>Pureza:Min. 95%RAB26 antibody
<p>RAB26 antibody was raised using the N terminal of RAB26 corresponding to a region with amino acids SRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRP</p>Pureza:Min. 95%GPSN2 antibody
<p>GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR</p>Pureza:Min. 95%LMF2 antibody
<p>LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS</p>Pureza:Min. 95%ATP1B1 antibody
<p>ATP1B1 antibody was raised using the middle region of ATP1B1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL</p>Pureza:Min. 95%DDAH1 antibody
<p>DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT</p>Pureza:Min. 95%CYTB antibody
<p>CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL</p>Pureza:Min. 95%TMEM16C antibody
<p>TMEM16C antibody was raised using the middle region of TMEM16C corresponding to a region with amino acids WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF</p>Pureza:Min. 95%CRMP1 antibody
<p>CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI</p>Pureza:Min. 95%RPSA antibody
<p>RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY</p>Pureza:Min. 95%Phkg1 antibody
<p>Phkg1 antibody was raised in rabbit using the N terminal of Phkg1 as the immunogen</p>Pureza:Min. 95%SYCP1 antibody
<p>SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV</p>Pureza:Min. 95%HELT antibody
<p>HELT antibody was raised in rabbit using the middle region of HELT as the immunogen</p>Pureza:Min. 95%HTR3A antibody
<p>HTR3A antibody was raised in rabbit using the middle region of HTR3A as the immunogen</p>Pureza:Min. 95%Aqp2 antibody
<p>Aqp2 antibody was raised in rabbit using the middle region of Aqp2 as the immunogen</p>Pureza:Min. 95%TIMP4 antibody
<p>TIMP4 antibody was raised in rabbit using the middle region of TIMP4 as the immunogen</p>Pureza:Min. 95%Dynactin 2 antibody
<p>Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI</p>Pureza:Min. 95%DOCK2 antibody
<p>DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA</p>Pureza:Min. 95%GIMAP5 antibody
<p>GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL</p>Pureza:Min. 95%MDC antibody
<p>MDC antibody was raised in rabbit using highly pure recombinant hMDC as the immunogen.</p>Pureza:Min. 95%MEGF9 antibody
<p>The MEGF9 antibody is a highly specialized antibody that targets the MEGF9 protein. This protein plays a crucial role in various biological processes, including iron homeostasis and growth factor signaling. The MEGF9 antibody has been shown to have neutralizing effects on the activity of MEGF9, making it an important tool for researchers in the field of life sciences.</p>Pureza:Min. 95%Notch 4 homolog antibody
<p>Notch 4 homolog antibody was raised in rabbit using a synthetic peptide representing an internal region of the human NOTCH homolog 4 (NOTCH4) protein as the immunogen.</p>Pureza:Min. 95%Inhibin α antibody
<p>Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP</p>Pureza:Min. 95%SLC25A44 antibody
<p>SLC25A44 antibody was raised in rabbit using the middle region of SLC25A44 as the immunogen</p>Pureza:Min. 95%MIP2 antibody
<p>MIP2 antibody was raised in rabbit using highly pure recombinant murine MIP-2 as the immunogen.</p>Pureza:Min. 95%TCEAL8 antibody
<p>TCEAL8 antibody was raised in rabbit using the middle region of TCEAL8 as the immunogen</p>Pureza:Min. 95%CA2 antibody
<p>CA2 antibody was raised in rabbit using the C terminal of CA2 as the immunogen</p>Pureza:Min. 95%MAGEA11 antibody
<p>MAGEA11 antibody was raised in rabbit using the middle region of MAGEA11 as the immunogen</p>Pureza:Min. 95%Ard1b antibody
<p>Ard1b antibody was raised in rabbit using the middle region of Ard1b as the immunogen</p>Pureza:Min. 95%MRE11A antibody
<p>MRE11A antibody was raised in rabbit using the middle region of MRE11A as the immunogen</p>Pureza:Min. 95%GABRA1 antibody
<p>GABRA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL</p>Pureza:Min. 95%ODF4 antibody
<p>ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL</p>Pureza:Min. 95%PRDM15 antibody
<p>PRDM15 antibody was raised in rabbit using the C terminal of PRDM15 as the immunogen</p>Pureza:Min. 95%OR1G1 antibody
<p>OR1G1 antibody was raised in rabbit using the C terminal of OR1G1 as the immunogen</p>Pureza:Min. 95%Chondroadherin antibody
<p>Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL</p>Pureza:Min. 95%ZNF562 antibody
<p>ZNF562 antibody was raised in rabbit using the middle region of ZNF562 as the immunogen</p>Pureza:Min. 95%OTUB2 antibody
<p>OTUB2 antibody was raised in rabbit using the N terminal of OTUB2 as the immunogen</p>Pureza:Min. 95%
