Anticuerpos primarios

<p>Rabbit polyclonal ATP5D antibody</p>

<p>ARHGEF16 antibody was raised in Rabbit using Human ARHGEF16 as the immunogen</p>

<p>The RAE1 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to the racemase enzyme, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in immobilizing the racemase enzyme, thereby inhibiting its activity.</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>Rabbit polyclonal ARFGAP3 antibody</p>

<p>The S6K1 antibody is a highly specific monoclonal antibody that can be used in various applications within the Life Sciences field. This antibody specifically targets and binds to the S6K1 protein, which plays a crucial role in cell growth, proliferation, and survival.</p>

<p>The VASP antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that targets the vasodilator-stimulated phosphoprotein (VASP), which plays a crucial role in cell signaling and cytoskeleton organization. This antibody can be used for various applications, including research on epidermal growth factor signaling pathways, cytotoxicity assays, and detection of VASP expression in different tissues and cell types.</p>

<p>The RNF125 antibody is a monoclonal antibody that specifically targets the TRPV4 protein. TRPV4 is a member of the transient receptor potential (TRP) family and plays a crucial role in various physiological processes. This antibody is designed to neutralize the activity of TRPV4, making it an essential tool for researchers studying TRPV4-related functions.</p>

<p>RANTES antibody was raised in mouse using highly pure human RANTES as the immunogen.</p>

<p>The SCAR antibody is a highly specific autoantibody that functions as an inhibitor of tyrosine. It is designed to target and block the activity of cortisol, a hormone involved in various physiological processes. By binding to cortisol, the SCAR antibody effectively reduces its concentration in the body. This low density cortisol has been shown to have therapeutic potential in assays and has been used as a medicament in the field of Life Sciences. Additionally, the SCAR antibody has demonstrated its ability to interact with other proteins such as vitronectin and androgen receptors. With its activated state, this antibody offers promising applications in research and clinical settings. For those seeking targeted therapies or investigating novel treatment options, the SCAR antibody provides a valuable tool for studying cortisol-related pathways and developing innovative approaches in healthcare.</p>

<p>The mGLUR5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting the androgen receptor and exerting cytotoxic effects on specific cells. This antibody also has the ability to neutralize certain growth factors, interferons, hepatocyte growth factors, and chemokines. Additionally, it exhibits antiviral properties by targeting glycoproteins involved in viral replication. The mGLUR5 antibody is a versatile tool that can be utilized in various research applications, including multidrug resistance studies and electrode-based assays. Its high specificity and potency make it an invaluable asset for scientists working in diverse fields of study.</p>

<p>KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS</p>

<p>AKR1CL2 antibody was raised in Rabbit using Human AKR1CL2 as the immunogen</p>

<p>Rabbit polyclonal RABL3 antibody</p>

<p>CD3e antibody (Azide free) was raised in rat using CD3e as the immunogen.</p>

<p>NDUFS1 antibody was raised in Rabbit using Human NDUFS1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Centaurin alpha 1 antibody</p>

<p>Rabbit polyclonal TAOK2 antibody</p>

<p>PSA antibody was raised in mouse using highly pure human PSA as the immunogen.</p>

<p>Rabbit polyclonal GDF15 antibody (HRP)</p>

<p>KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN</p>

<p>RG9MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE</p>

<p>The Paxillin antibody is a biomolecule that plays a crucial role in various cellular processes. It acts as a substrate for protein kinases and is involved in the regulation of cell adhesion and migration. This antibody can be used in research studies to investigate the function of paxillin and its interactions with other proteins.</p>

<p>XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH</p>

<p>Rabbit polyclonal YEATS4 antibody</p>

<p>The ASK1 antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the adeno-associated virus (AAV), preventing its replication and spread. It has been extensively tested on various cell types, including mesenchymal stem cells, showing excellent results in inhibiting viral infection. Additionally, this antibody has demonstrated its potential as an antiviral therapy by effectively blocking the entry of influenza hemagglutinin into human serum.</p>

<p>DLX1 antibody was raised in Rabbit using Human DLX1 as the immunogen</p>

<p>EIF4ENIF1 antibody was raised using the N terminal of EIF4ENIF1 corresponding to a region with amino acids DSDGLRLLGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDK</p>

<p>Rabbit polyclonal HDAC2 antibody (Ser394)</p>

<p>MTHFD2 antibody was raised in Rabbit using Human MTHFD2 as the immunogen</p>

<p>Rabbit polyclonal DNAJC5 antibody</p>

<p>GRIN2B antibody was raised in Rabbit using Human GRIN2B as the immunogen</p>

<p>Goat anti-syrian Hamster IgG (H + L) (rhodamine) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal LASS4 antibody</p>

<p>The Apolipoprotein C2 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and inhibits the function of apolipoprotein C2, a protein involved in lipid metabolism. By blocking the activity of apolipoprotein C2, this antibody can be used to study its role in various biological processes.</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Rabbit polyclonal Musashi 2 antibody</p>

<p>LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST</p>

<p>hCG antibody was raised in mouse using the beta subunit of hCG as the immunogen.</p>

<p>PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP</p>

<p>Rabbit polyclonal ACOT12 antibody</p>

<p>TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN</p>

<p>Rabbit polyclonal PSMD11 antibody</p>

<p>Mouse monoclonal CNOT4 antibody</p>

<p>Rabbit polyclonal PIP5K antibody</p>

<p>Rabbit polyclonal RAD23B antibody</p>

<p>Purified Rabbit polyclonal OR10H2 antibody</p>

<p>LRRC28 antibody was raised using the N terminal of LRRC28 corresponding to a region with amino acids KDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIG</p>

<p>The RB antibody is an antibody-drug that specifically targets the tyrosine kinase receptor known as RB. This receptor plays a crucial role in regulating cell growth and division. By binding to the tyrosine residues on the RB receptor, this antibody inhibits its activity, leading to a decrease in cell proliferation.</p>

<p>Rabbit polyclonal TMEM108 antibody</p>