Anticuerpos primarios

<p>EXOSC1 antibody was raised in Rabbit using Human EXOSC1 as the immunogen</p>

<p>SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen</p>

<p>Rabbit polyclonal RFXAP antibody</p>

<p>PLMN antibody is an essential tool used in life sciences research for the detection and analysis of various proteins and peptides. This polyclonal antibody specifically targets c-myc, a hormone peptide that plays a crucial role in cell growth and proliferation. The PLMN antibody is highly sensitive and can detect even low levels of c-myc in samples.</p>

<p>Rabbit polyclonal LMX1B antibody</p>

<p>Mouse monoclonal BCAR1 antibody</p>

<p>GPR174 antibody was raised in rabbit using the C terminal of GPR174 as the immunogen</p>

<p>Aquaporin 4 antibody is a biomolecule that plays a crucial role in various physiological processes. It is a polyclonal antibody that specifically targets the aquaporin 4 protein, which is found in the central nervous system and plays a key role in water transport across cell membranes. This antibody is widely used in life sciences research to study the function and regulation of aquaporin 4.</p>

<p>The ST6GALNAC1 antibody is a powerful tool for researchers in the field of life sciences. It is an antibody that specifically targets and binds to ST6GALNAC1, an enzyme involved in the synthesis of sialyl-Tn antigen. This antigen has been implicated as a diagnostic biomarker for various cancers, making the ST6GALNAC1 antibody a valuable theranostic tool.</p>

<p>Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED</p>

<p>The Tip60 antibody is a monoclonal antibody that is widely used in Life Sciences research. It acts as a growth factor by neutralizing the effects of certain proteins, such as collagen and androgen. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is available as both monoclonal and polyclonal antibodies to suit different experimental needs. The Tip60 antibody has been shown to have multidrug resistance-associated protein (MRP) inhibitory activity, making it useful for studying drug resistance mechanisms. Additionally, it interacts with cytochrome proteins involved in cellular metabolism. The Tip60 antibody is formulated with low-density excipients to ensure stability and optimal performance.</p>

<p>CD86 antibody was raised in rat using LPS-activated murine B cells as the immunogen.</p>

<p>EFTUD2 antibody was raised in Rabbit using Human EFTUD2 as the immunogen</p>

<p>The FHL1 antibody is a cytotoxic monoclonal antibody that acts as a family kinase inhibitor. It targets tyrosine residues and neutralizes chemokines, including TNF-α. This antibody has been shown to have high affinity for collagen and can effectively block the activity of antibodies that are involved in superoxide production. Additionally, the FHL1 antibody has been found to be highly reactive with liver microsomes, making it a valuable tool for studying liver function. With its potent inhibitory properties and specificity, the FHL1 antibody is an essential tool for researchers in the field of immunology.</p>

<p>SMAD3 antibody was raised in Mouse using a purified recombinant fragment of human SMAD3 expressed in E. coli as the immunogen.</p>

<p>MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids KKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTSVDVSYKKSYK</p>

<p>OR2W5 antibody was raised using the middle region of OR2W5 corresponding to a region with amino acids SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT</p>

<p>RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV</p>

<p>Rabbit polyclonal CKMT2 antibody</p>

<p>Purified Rabbit polyclonal MPK7 antibody</p>

<p>Mouse monoclonal SCYL3 antibody</p>

<p>The BHMT antibody is a monoclonal antibody that specifically targets CD33, a receptor protein expressed on the surface of certain cells. This antibody is widely used in Life Sciences research and immunoassays to detect and study CD33-related processes. The BHMT antibody has a high affinity for CD33 due to its unique binding site, which allows for accurate and reliable detection. It can be used in various applications such as flow cytometry, immunohistochemistry, and Western blotting. Additionally, this antibody has been utilized in studies investigating collagen synthesis, disulfide bond formation, glucagon signaling, TNF-α inhibition, and the presence of autoantibodies. With its exceptional specificity and sensitivity, the BHMT antibody is an invaluable tool for researchers studying CD33-related pathways and diseases.</p>

<p>NARS antibody was raised in Rabbit using Human NARS as the immunogen</p>

<p>Rabbit polyclonal TSEN2 antibody</p>

<p>Rabbit polyclonal SENP2 antibody</p>

<p>The DTNB antibody is a highly specialized product in the field of Life Sciences. It belongs to the group of chemokine antibodies and is widely used in various immunoassays. This antibody specifically targets a specific molecule and can be used for the detection and quantification of this target in samples.</p>

<p>Rabbit polyclonal GPI antibody (HRP)</p>

<p>Purified Polyclonal Profilin 2 antibody</p>

<p>EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV</p>

<p>The POT1 antibody is a polyclonal antibody that specifically targets brain natriuretic peptide (BNP). It belongs to the class of antibodies known as neutralizing antibodies and is widely used in life sciences research. The POT1 antibody is derived from globulin and has high affinity for BNP, making it an effective tool for studying the function and regulation of this peptide.</p>

<p>DEF6 antibody was raised in Rabbit using Human DEF6 as the immunogen</p>

<p>Ajuba Monoclonal Antibody</p>

<p>C9ORF153 antibody was raised using the middle region of C9Orf153 corresponding to a region with amino acids NEAQEVLARNLNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKIN</p>

<p>CYLD antibody was raised in Rabbit using Human CYLD as the immunogen</p>

<p>Rabbit polyclonal MAGI2 antibody</p>

<p>C5ORF35 antibody was raised using the N terminal Of C5Orf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL</p>

<p>CDKN2C antibody was raised in Rabbit using Human CDKN2C as the immunogen</p>

<p>POLR2K antibody was raised using the middle region of POLR2K corresponding to a region with amino acids DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR</p>

<p>Rabbit polyclonal AQP11 antibody</p>

<p>PLP1 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It specifically targets and binds to PLP1, a protein expressed in cardiomyocytes. This antibody has been shown to modulate mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in cell growth and differentiation. Additionally, PLP1 antibody can be used in Life Sciences research as a tool for studying the functions of PLP1 and its implications in various physiological processes. This monoclonal antibody is highly specific and exhibits high affinity for PLP1, making it an ideal choice for experiments requiring precise targeting of this protein. Furthermore, PLP1 antibody has been validated for use in human serum samples and has shown activation of protein kinase pathways.</p>

<p>Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA</p>

<p>Rabbit Polyclonal AFX antibody</p>

<p>C1QTNF1 antibody was raised in Rabbit using Human C1QTNF1 as the immunogen</p>

<p>Rabbit Polyclonal CBCP3 antibody</p>

<p>C18ORF32 antibody was raised using the middle region of C18Orf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK</p>

<p>Mouse monoclonal SMYD2 antibody</p>

<p>Rabbit polyclonal Ovotransferrin antibody (biotin)</p>

<p>HSPH1 antibody was raised in Rabbit using Human HSPH1 as the immunogen</p>

<p>Ftsj3 antibody was raised in rabbit using the C terminal of Ftsj3 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>