Anticuerpos primarios

<p>PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR</p>

<p>TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV</p>

<p>SYT5 antibody was raised in rabbit using the middle region of SYT5 as the immunogen</p>

<p>SOX7 antibody was raised in rabbit using the middle region of SOX7 as the immunogen</p>

<p>CDH5 antibody was raised in rabbit using the middle region of CDH5 as the immunogen</p>

<p>St6gal2 antibody was raised in rabbit using the C terminal of St6gal2 as the immunogen</p>

<p>ZFP90 antibody was raised in rabbit using the middle region of ZFP90 as the immunogen</p>

<p>The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.</p>

<p>BD4 antibody was raised in rabbit using highly pure recombinant human BD-4 as the immunogen.</p>

<p>ATP6V0A1 antibody was raised using the N terminal of ATP6V0A1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE</p>

<p>LIMD1 antibody was raised in rabbit using the N terminal of LIMD1 as the immunogen</p>

<p>PSME2 antibody was raised in rabbit using the middle region of PSME2 as the immunogen</p>

<p>Rabbit polyclonal MAP2K7 antibody (Ser271)</p>

<p>The PKC delta antibody is a highly specific and potent tool used in life sciences research. It targets the protein kinase C delta, an enzyme involved in various cellular processes such as glucose transporter activation and growth factor signaling. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific experimental needs.</p>

<p>NORE1 antibody was raised in rabbit using residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein as the immunogen.</p>

<p>IL13 antibody was raised in rabbit using highly pure recombinant human IL-13 as the immunogen.</p>

<p>Purified Polyclonal 14 3 3 theta antibody</p>

<p>PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ</p>

<p>PSMD9 antibody was raised in rabbit using the middle region of PSMD9 as the immunogen</p>

<p>PCBD1 antibody was raised in rabbit using the C terminal of PCBD1 as the immunogen</p>

<p>Purified Polyclonal CDKL4 antibody</p>

<p>POPDC2 antibody was raised using the middle region of POPDC2 corresponding to a region with amino acids SLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSL</p>

<p>Purified Polyclonal CRHR1 antibody</p>

<p>SCRT2 antibody was raised in rabbit using the middle region of SCRT2 as the immunogen</p>

<p>Cdx1 antibody was raised in rabbit using the C terminal of Cdx1 as the immunogen</p>

<p>MLPH antibody was raised in rabbit using the C terminal of MLPH as the immunogen</p>

<p>STK11 antibody was raised in rabbit using the C terminal of STK11 as the immunogen</p>

<p>PLD2 antibody was raised in rabbit using the middle region of PLD2 as the immunogen</p>

<p>GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY</p>

<p>ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN</p>

<p>CNTN1 antibody was raised in rabbit using the middle region of CNTN1 as the immunogen</p>

<p>Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE</p>

<p>Please enquire for more information about Dengue Virus Type 2 NS1 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pig RBC antibody was raised in rabbit using porcine erythrocytes as the immunogen.</p>

<p>Monoclonal antibody against EGFR</p>

<p>Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Human Nectin-4 Monoclonal Antibody</p>

<p>Please enquire for more information about Dengue Virus Type 3 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Androstenedione antibody is a highly specialized antibody that targets and binds to androstenedione, a hormone involved in the production of testosterone and estrogen. This antibody has been extensively studied for its role in various research areas, including hormone regulation, reproductive health, and cancer studies.</p>

<p>Blinatumomab is a bispecific T-cell engager (BiTE), an immunotherapy specifically designed to target and redirect the body's immune system to attack cancer cells. This is possible as Blinatumomab has two single-chain antibody variable fragments. One of these targets CD3+ on T-cells while the other recognizes CD19 on malignant B-cells. As such the body's T-cells become activated and exert cytotoxic activity on the target cell.<br>Blinatumomab has been approved for the treatment of a type of acute lymphoblastic leukemia (ALL) called Philadelphia chromosome-negative B-cell precursor ALL. This medication has demonstrated efficacy in patients with relapsed or refractory ALL, and it has also been used in the minimal residual disease (MRD) setting to help eliminate any remaining cancer cells after initial treatment. <br>One advantage of Blinatumomab is that, CD3 and CD19 are present in both pediatric and adult patients. As such it can be a potential therapeutic for both patient sets.</p>

<p>Sheep polyclonal Creatinine Acid antibody</p>

<p>Anti-Human PCSK9 Monoclonal Antibody; 98%</p>

<p>Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment</p>

<p>Contains 0.1% Proclin300 as preservative</p>

<p>NCGC00229600: Allosteric inverse TSHR agonist; blocks TSH and antibody TSHR activation; for Graves' disease research.</p>

<p>CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.</p>

<p>The Methotrexate antibody is a monoclonal antibody that specifically targets and binds to Methotrexate, a commonly used cytotoxic drug in the field of Life Sciences. This antibody has been extensively tested and validated for its high affinity and specificity towards Methotrexate. It can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The Methotrexate antibody works by binding to Methotrexate molecules and preventing their interaction with their target enzymes involved in DNA synthesis. This inhibits the growth of cancer cells and autoimmune responses mediated by activated T-cells. Additionally, this antibody can also be utilized as a tool for studying the intracellular localization and trafficking of Methotrexate within cells. The unique features of this Methotrexate antibody include its ability to recognize both free Methotrexate molecules as well as Methotrexate conjugated to proteins or other biomolecules. It exhibits minimal cross-reactivity with</p>

<p>Mucin antibody was raised in mouse using Mucin isolated from ovarian mucinous cysts and colonic mucosa as the immunogen.</p>