Anticuerpos primarios

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>HIV2 p26 antibody was raised in mouse using purified, full length recombinant p26 (HIV-2 ROD) produced in E. coli expression system as the immunogen.</p>

<p>Mouse monoclonal HSV2 gD antibody</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Substance P antibody was raised in rabbit using substance P-BSA as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Estradiol antibody was raised in rabbit using estradiol-6-protein preparation as the immunogen.</p>

<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>

<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>

<p>HIV1 Nef antibody (FITC) was raised using purified recombinant nef (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.</p>

<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>

<p>FSH antibody was raised in mouse using highly purified FSH as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Human monoclonal antibody targeting activin receptor type-2B; treatment of muscle loss and weakness</p>

<p>Humanized anti-CD19 IgG1 monoclonal antibody</p>

<p>A chimeric human/macaque IgG1 anti-CD4 monoclonal antibody</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>

<p>Anti-Human IFNA1 Monoclonal Antibody</p>

<p>Goat polyclonal Human  Complement 3D antibody</p>

<p>Rabbit Polyclonal HIV1 protease antibody; 1mg/ml; Supplied in frozen form.</p>

<p>The Chikungunya virus antibody is a growth factor that belongs to the Life Sciences category. It is a colloidal solution containing histidine and cyclic peptides. This antibody is specifically designed to target and neutralize the Chikungunya virus, which is responsible for causing the Chikungunya fever in humans. The antibody works by binding to viral proteins and preventing them from infecting healthy cells. In addition to its antiviral properties, this antibody has been extensively tested for safety and efficacy. It has shown high specificity and affinity towards the Chikungunya virus, making it an ideal tool for research purposes. Scientists can use this antibody in various applications such as immunohistochemistry, ELISA assays, and Western blotting. Furthermore, this product includes monoclonal antibodies that have been developed using advanced techniques. These monoclonal antibodies offer superior specificity and consistency compared to polyclonal antibodies. They are highly purified and free from contaminants, ensuring reliable results in experiments. The Chik</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.</p>

<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>

<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.</p>

<p>Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.</p>

<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>CKMM antibody was raised in goat using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>

<p>Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.</p>

<p>Anti-Ferritin monoclonal antibody; &gt;95% pure (SDS-PAGE)</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE</p>