Anticuerpos primarios

HBsAg antibody was raised in mouse using hepatitis B Virus as the immunogen.

<p>CBP antibody was raised in mouse using recombinant Creb-Binding Protein (Cbp)</p>

This polyclonal antibody product: affinity purified Sheep Anti-HIV-1-gp120 was produced by first immunising sheep with a single synthetic peptide which has the amino acid sequence: APTKAKRRVVQREKR. This amino acid sequence corresponds to amino acid section 497-511 in the envelope gene gp120 protein of the BH-10 strain of HIV-1. The antibodies are then isolated from the sheep hyperimmune serum by affinity chromatography using the APTKAKRRVVQREKR sequenced synthetic peptide coupled to Sepharose. The serological activity of the antibodies is checked by ELISA and lyophilised in PBS. 0.15M NaCl (pH 7.4) without preservative. The glycoprotein gp120 is an essential Human Immunodeficiency virus (HIV) envelope subunit which facilitates the entry of the HIV into CD4 T cells through binding to CD4 receptors and CCR5 or CXCR4 chemokine co-receptors on host cells. This attachment enables the second key envelope glycoprotein gp41 to form a six-helix bundle and therefore fuse to the host cell membrane. This HIV gp120 complementary antibody can be used to detect the presence of the HIV gp120 subunit in antigen detection assays such as ELISA, automated immunoassays, western blot and lateral flow.

The GAPDH antibody is a highly effective monoclonal antibody used in various applications in the field of Life Sciences. It has been extensively studied and proven to be valuable in research related to thrombocytopenia, mcf-7 cells, hyaluronic acid metabolism, and epidermal growth factors.

The Testosterone antibody is a highly specific monoclonal antibody designed for the detection and quantification of testosterone, a serum hormone that plays a crucial role in various physiological processes. This antibody is widely used in life sciences research, clinical diagnostics, and pharmaceutical development.

Parvovirus antibody was raised in mouse using canine parvovirus as the immunogen.

CA 15-3 antibody was raised in mouse using human CA 15-3 antigen from a human cell line as the immunogen.

V5 Tag antibody was raised in mouse using GKPIPNPLLGLDST (V5) synthetic peptide conjugated to KLH as the immunogen.

Human IgM antibody was raised in mouse using immunoglobulin M Fab region as the immunogen.

Mouse monoclonal Vibrio cholerae O139 antibody

<p>GARS antibody was raised in Rabbit using Human GARS as the immunogen</p>

IL8 antibody was raised in mouse using recombinant human IL8 as the immunogen.

Mouse monoclonal HPV11 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. With its specific binding ability to markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. With its bactericidal activity and effectiveness against tuberculosis infection, it stands as one of the most active compounds in treating this condition. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its metabolism involves various transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

<p>Plakophilin 3 antibody was raised in mouse using recombinant protein (E.Coli) of human plakophilin 3 as the immunogen.</p>

HSV2 antibody was raised in mouse using HSV2 as the immunogen.

Calcitonin antibody is a growth factor that plays a crucial role in regulating calcium and phosphate levels in the body. It is an antibody that specifically targets calcitonin, a hormone involved in bone metabolism. This monoclonal antibody is highly specific and has been developed for use in life sciences research. It can be used to study the function of calcitonin and its effects on various biological processes.

<p>Legionella pneumophila (serogroup 1) antibody was raised in mouse using Legionella pneumophila antigenic subgroup knoxville 1 as the immunogen.</p>

<p>Cytokeratin 8 antibody (biotin) was raised in mouse using cytoskeletal proteins from cultured HeLa Cells as the immunogen.</p>

The CKMB antibody is a highly specialized product used in the field of Life Sciences. It belongs to the class of Antibodies and specifically targets CKMB dimers. This Monoclonal Antibody is designed to immobilize and neutralize activated CKMB, which is crucial for accurate diagnostic testing.

GTF2H4 antibody was raised in mouse using recombinant Human General Transcription Factor Iih, Polypeptide 4, 52Kda

<p>Influenza B antibody was raised in mouse using a nuclear protein from the Singapore strain of influenza B as the immunogen.</p>

<p>Helicobacter pylori antibody is a monoclonal antibody that specifically targets the Helicobacter pylori bacteria. This antibody is used for diagnostic purposes to detect the presence of H. pylori in human serum samples. It works by binding to specific antigens on the surface of the bacteria, allowing for easy detection through particle chemiluminescence or colloidal methods. The Helicobacter pylori antibody can also be used as an anti-connexin agent, inhibiting connexin-mediated cell communication. Additionally, this antibody has been shown to have anticoagulant properties, possibly due to its interaction with phosphorylcholine or hydrogen atoms on the bacterial surface. With its high specificity and sensitivity, the Helicobacter pylori antibody is an essential tool in diagnosing and studying H. pylori infections.</p>

Gentamicin antibody was raised in mouse using gentamicin conjugated to KLH as the immunogen.

Aflatoxin B antibody was raised in mouse using aflatoxin B as the immunogen.

<p>Complement C3a alpha antibody was raised in mouse using human complement component C3 as the immunogen.</p>

Desmoglein 2 antibody was raised in mouse using Desmoglein 2 as the immunogen.

HBeAg antibody was raised in mouse using recombinant HBeAg as the immunogen.

Transferrin antibody was raised in mouse using human transferrin as the immunogen.

<p>Granzyme B antibody was raised in mouse using recombinant granzyme B as the immunogen.</p>

IRF3 antibody was raised in mouse using recombinant Interferon Regulatory Factor 3

The Testosterone antibody is a powerful tool for researchers and scientists working in the field of endocrinology. This monoclonal antibody specifically targets testosterone, a hormone that plays a crucial role in various physiological processes. The Testosterone antibody has been extensively tested and validated for its specificity and sensitivity. It binds to testosterone with high affinity, allowing for accurate detection and quantification of this hormone in biological samples. One of the key applications of the Testosterone antibody is its use in immunoassays, such as ELISA or Western blotting. By utilizing this antibody, researchers can measure testosterone levels in serum, plasma, or tissue extracts with great precision. Additionally, the Testosterone antibody can be used for immunohistochemistry (IHC) to visualize the localization of testosterone within tissues. This technique provides valuable insights into the distribution and expression patterns of testosterone in various organs and cell types. Moreover, this antibody has been shown to have minimal cross-reactivity with other related hormones or compounds, ensuring accurate

<p>TLK2 antibody was raised using the N terminal of TLK2 corresponding to a region with amino acids VSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKN</p>

Keratin K5/K8 (Pan Epithelial) antibody (biotin) was raised in mouse using human keratin K8, purified from SDS PAGE gel as the immunogen.

<p>FSH antibody is a monoclonal antibody that specifically targets follicle-stimulating hormone (FSH). It binds to FSH and inhibits its activity, which plays a crucial role in the regulation of the reproductive system. This antibody has been extensively used in immunoassays to detect and quantify FSH levels in human serum. Additionally, FSH antibody has shown potential therapeutic applications in various conditions such as cancer and autoimmune diseases. Its cytotoxic properties make it an effective tool for targeted therapy against FSH receptor-expressing cells. Furthermore, FSH antibody has been studied for its role in melanogenesis, as it inhibits tyrosinase activity and reduces the production of melanin.</p>

Procalcitonin antibody is a monoclonal antibody that targets procalcitonin, a protein that is involved in various biological processes. This antibody is widely used in Life Sciences research to study the role of procalcitonin in endothelial growth, alpha-fetoprotein regulation, and other physiological functions. The high specificity and affinity of this monoclonal antibody make it an excellent tool for detecting and quantifying procalcitonin levels in various samples. It can be used in techniques such as immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), Western blotting, and flow cytometry. Additionally, this antibody can be conjugated with different labels or enzymes for easy detection and visualization. Whether you are studying procalcitonin's involvement in cancer, inflammation, or other diseases, this highly reliable and versatile antibody will provide accurate and reproducible results.

<p>The CYFRA21-1 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It targets the CYFRA21-1 protein, which is an important biomarker for various types of cancer, including lung and bladder cancer. This antibody has been shown to inhibit the activity of interferon and collagen, two proteins involved in tumor growth and metastasis. Additionally, it has the ability to bind to alpha-fetoprotein in human serum, making it a valuable tool for diagnostic purposes. The CYFRA21-1 antibody also exhibits inhibitory effects on transferrin, a protein involved in iron transport, as well as lipoprotein lipase, which plays a role in lipid metabolism. With its high specificity and superior performance, this antibody is an essential component in cancer research and diagnostics.</p>

<p>Human IgG antibody (Fc) was raised in mouse using affinity pure hum#an IgG Fc as the immunogen.</p>

CART1 antibody was raised in mouse using recombinant Human Cartilage Paired-Class Homeoprotein 1 (Cart1)

CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.

USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH

Alpha tubulin antibody was raised in mouse using alpha-tubulin isolated from chick brain microtubules as the immunogen.

ADCY3 antibody was raised in Rabbit using Human ADCY3 as the immunogen

Borrelia burgdorferi antibody was raised in mouse using affinity purified Borrelia burgdorferi as the immunogen.

CD4 antibody was raised in mouse using hybridoma of X63.653 myeloma with spleen cells of Balb/c mice immunized with normal human blood lymphocytes.

<p>TSH antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody designed to specifically target and bind to TSH (thyroid-stimulating hormone). This antibody is commonly used in bioassays to study the antigen-antibody reaction and its effects on various biological processes.</p>

Neisseria Gonorrhoeae Antibody is a monoclonal antibody known as trastuzumab that specifically targets Neisseria gonorrhoeae, the bacteria responsible for causing gonorrhea. This antibody is designed to bind to specific antigens on the surface of the bacteria, leading to their destruction by the immune system. It has been shown to be effective in neutralizing the bacteria and preventing their growth and spread. This antibody can be used in diagnostic tests to detect the presence of Neisseria gonorrhoeae in human serum samples. Additionally, it can be conjugated with streptavidin or other molecules for use in research applications such as immunohistochemistry or flow cytometry. The Neisseria Gonorrhoeae Antibody offers a reliable and accurate tool for the detection and study of this common sexually transmitted infection.

Penicillin Antibody is a monoclonal antibody that specifically targets and neutralizes the effects of penicillin. It is widely used in the field of life sciences for various applications. This antibody has been extensively tested and validated using luciferase assays, electrochemical impedance spectroscopy, and other techniques. It has been shown to effectively bind to penicillin molecules, preventing their interaction with target receptors and inhibiting their biological activity. Additionally, Penicillin Antibody has been found to reduce the levels of interleukin-6 (IL-6) and cortisol concentration in test subjects, indicating its potential as an anti-inflammatory agent. With its high specificity and potency, this antibody offers a valuable tool for researchers studying penicillin-related phenomena in both academic and industrial settings.

MAT2A antibody was raised in mouse using recombinant human MAT2A (1-395aa) purified from E. coli as the immunogen.