Anticuerpos primarios

<p>Rabbit polyclonal RNR antibody (FITC)</p>

<p>Drosophila FMR1 Monoclonal Antibody</p>

<p>FBXO36 antibody was raised using the N terminal of FBXO36 corresponding to a region with amino acids QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD</p>

<p>Affinity purified Rabbit polyclonal LOC283129 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, it binds to DNA-dependent RNA polymerase, preventing transcription and replication, effectively inhibiting bacterial growth. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique, which have shown its high efficacy.</p>

<p>GCC1 antibody was raised in Rabbit using Human GCC1 as the immunogen</p>

<p>CD164 antibody was raised in Rabbit using Human CD164 as the immunogen</p>

<p>GDI2 antibody was raised in rabbit using the C terminal of GDI2 as the immunogen</p>

<p>FECH antibody was raised in Rabbit using Human FECH as the immunogen</p>

<p>The FOS antibody is a glycoprotein that belongs to the family of epidermal growth factor (EGF)-like antibodies. It contains sugar moieties that enhance its stability and functionality. This antibody has been shown to have endonuclease activity, which allows it to cleave DNA at specific sites. Additionally, it exhibits glutamate and hyaluronidase activity, making it useful in various biochemical assays. The FOS antibody can also be pegylated to increase its half-life and improve its pharmacokinetic properties. In life sciences research, this antibody is commonly used for immunostaining and Western blotting experiments. Its high specificity and affinity make it an excellent tool for studying protein expression patterns and understanding cellular signaling pathways. Furthermore, the FOS antibody has been shown to inhibit microvessel density and collagen synthesis, suggesting potential therapeutic applications in angiogenesis-related disorders. Its ability to modulate TGF-beta signaling further expands its potential use in cancer research and tissue engineering studies.</p>

<p>DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL</p>

<p>The MARK4 antibody is a monoclonal antibody that specifically targets and neutralizes the chemokine endothelial growth protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been used to study the role of EGFR protein and TGF-beta signaling pathways, as well as its potential therapeutic effects on amyloid plaque formation. Additionally, the MARK4 antibody has been found to inhibit caspase-9 activity and regulate ornithine metabolism. With its high specificity and potency, this antibody is a valuable tool for researchers investigating various cellular processes and molecular mechanisms.</p>

<p>Purified Rabbit polyclonal WRKY12.1 antibody</p>

<p>Keratin K19 antibody was raised in Mouse using a purified recombinant fragment of Keratin K19(aa80-400) expressed in E. coli as the immunogen.</p>

<p>The FMO2 antibody is a monoclonal antibody that has been developed for its potential use as a medicament in the field of Life Sciences. This antibody exhibits cytotoxic properties and has been shown to induce cell cytotoxicity in various studies. It specifically targets and binds to a growth factor known as phosphorylcholine, inhibiting its activity and preventing further cell growth.</p>

<p>PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD</p>

<p>Fascin antibody is a highly specific monoclonal antibody that targets fascin, a protein involved in cell migration and adhesion. It binds to histidine residues on the fascin molecule, inhibiting its function and preventing tumor metastasis. This antibody has been extensively studied in various research fields, including cancer biology and immunology. Fascin antibody can be used in experiments to detect fascin expression levels in human serum samples or tissue sections. Additionally, it has been shown to have cytotoxic effects on cancer cells and can be used as a therapeutic agent in cancer treatment. The use of this antibody has also been explored in autoimmune diseases, where autoantibodies targeting fascin have been identified. Overall, Fascin antibody is a valuable tool for researchers in the Life Sciences field who are studying cell migration, tumor metastasis, and autoimmunity.</p>

<p>NECAB3 antibody was raised using the N terminal of NECAB3 corresponding to a region with amino acids MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK</p>

<p>Rabbit polyclonal CXCL10 antibody (FITC)</p>

<p>ETFA antibody was raised in Rabbit using Human ETFA as the immunogen</p>

<p>Rabbit polyclonal CYC1 antibody (FITC)</p>

<p>RBM8A antibody was raised using the N terminal of RBM8A corresponding to a region with amino acids LHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDS</p>

<p>Rabbit polyclonal MKNK1 antibody</p>

<p>Rabbit polyclonal GPR109 antibody</p>

<p>The LIMK2 antibody is a peptide agent that specifically binds to LIM kinase 2 (LIMK2), a protein involved in cellular processes such as cell migration, proliferation, and differentiation. This antibody can be used for various applications, including immunoprecipitation, western blotting, and immunofluorescence. It is produced using monoclonal antibody technology, ensuring high specificity and sensitivity. The LIMK2 antibody has been shown to neutralize the activity of LIMK2 and inhibit its downstream signaling pathways. Additionally, it can be used to study the glycosylation patterns of LIMK2 and its binding proteins. This antibody offers researchers a valuable tool for investigating the role of LIMK2 in various biological processes and may have potential therapeutic applications in diseases associated with abnormal LIMK2 activity.</p>

<p>Rabbit polyclonal PGBD1 antibody</p>

<p>GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT</p>

<p>CD4a antibody was raised in mouse using CD4a as the immunogen.</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>The BNP antibody is a monoclonal antibody that specifically targets brain natriuretic peptide (BNP). It is designed for use in various applications, including immunoassays and research studies. This antibody has been shown to effectively detect BNP in human serum samples, making it a valuable tool for diagnostic purposes.</p>

<p>Affinity purified Rabbit polyclonal Calpain 5 antibody</p>

<p>Purified Polyclonal ARHGEF1 antibody</p>

<p>Purified Rabbit polyclonal MKK9t antibody</p>

<p>C17ORF81 antibody was raised using the C terminal Of C17Orf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE</p>

<p>Rabbit polyclonal XRN2 antibody</p>

<p>Affinity purified Chicken polyclonal Integrin alpha M antibody</p>

<p>FAM98B antibody was raised using the N terminal of FAM98B corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI</p>

<p>MMACHC antibody was raised in rabbit using the C terminal of MMACHC as the immunogen</p>

<p>TERF2IP antibody was raised using the middle region of TERF2IP corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV</p>

<p>BAG5 antibody was raised in rabbit using the C terminal of BAG5 as the immunogen</p>

<p>Rabbit polyclonal PPM1K antibody</p>

<p>CD11b antibody was raised in mouse using human CD11-b`/Mac-1alpha as the immunogen.</p>

<p>CKMT1A antibody was raised in Rabbit using Human CKMT1A as the immunogen</p>

<p>Affinity purified Rabbit polyclonal PODXL2 antibody</p>

<p>Rabbit polyclonal AP2S1 antibody (HRP)</p>

<p>Rabbit polyclonal Adiponectin antibody (HRP)</p>

<p>Rabbit polyclonal NUDT16 antibody</p>

<p>The Aggrecan antibody is a growth factor that belongs to the class of antibodies. It is a monoclonal antibody with low density and globulin inhibitors. This antibody specifically targets hyaluronic acid, epidermal growth factor, antigens, interferons, and fatty acids. The Aggrecan antibody is widely used in the field of life sciences and has been shown to have neutralizing effects on its target molecules. Its high specificity and efficacy make it an essential tool for researchers in various scientific disciplines.</p>

<p>The BRD3 antibody is a highly specialized antibody preparation that has various applications in the field of life sciences. It is commonly used in research involving pluripotent stem cells, antimicrobial peptides, and interleukin-6. This antibody has been shown to induce apoptosis and neutralize certain growth factors, making it an essential tool for studying cellular processes and signaling pathways. The BRD3 antibody can be used in techniques such as transcription-polymerase chain reaction (PCR) and mitogen-activated protein assays. It is available both as polyclonal antibodies and monoclonal antibodies, providing researchers with options based on their specific needs. Additionally, this antibody can be used in conjunction with AMPK activators and colony-stimulating factors to further enhance its effects. With its versatility and reliability, the BRD3 antibody is an invaluable asset for scientists conducting cutting-edge research in various fields of study within the life sciences domain.</p>

<p>PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH</p>