Anticuerpos primarios

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal TNNC1 antibody</p>

<p>Purified Rabbit polyclonal OSBPL10 antibody</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>NEIL2 antibody was raised in mouse using recombinant Human Nei Like 2 (E. Coli)</p>

<p>The LOX antibody is a reactive monoclonal antibody that is activated through chromatographic techniques. It is specifically designed to target and bind to LOX, a chemokine involved in various cellular processes. This antibody has been extensively used in research studies, such as Western blotting and immunohistochemistry, to detect the presence and localization of LOX in different tissues and cell types. Additionally, the LOX antibody has shown promising results in multidrug resistance studies, particularly in cardiomyocytes where it inhibits the efflux of anticancer drugs. Furthermore, this monoclonal antibody has demonstrated its potential therapeutic applications in regulating glucagon secretion and modulating polyunsaturated fatty acid metabolism. With its high specificity and affinity, the LOX antibody is an invaluable tool for researchers in the life sciences field.</p>

<p>Rabbit polyclonal ARHGDIA antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Purified Polyclonal CK1 gamma 3 antibody</p>

<p>The CLPP antibody is a monoclonal antibody that targets collagen, a crucial component in the growth and development of various tissues. This antibody has been extensively studied for its potential therapeutic applications in promoting the growth and differentiation of mesenchymal stem cells. It works by binding to specific receptors on the surface of these cells, triggering a series of signaling events that promote cell proliferation and tissue regeneration.</p>

<p>Mouse monoclonal Plakophilin 3 antibody</p>

<p>Mouse monoclonal Cytokeratin 13 antibody</p>

<p>IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR</p>

<p>GSTO1 antibody was raised in Rabbit using Human GSTO1 as the immunogen</p>

<p>The MUC2 Antibody is a monoclonal antibody that targets a specific cell antigen. It belongs to the class of neutralizing antibodies and has been shown to have histidine residues that enhance its binding affinity. This antibody is commonly used in research and diagnostic applications to detect and quantify MUC2 levels in various biological samples, such as human serum or tissue sections.</p>

<p>Rabbit polyclonal SH2 antibody (Tyr542)</p>

<p>Rabbit polyclonal HAX1 antibody (FITC)</p>

<p>Mouse monoclonal DSTN antibody</p>

<p>The CRYAB antibody is a powerful diagnostic agent used in the field of Life Sciences. This antibody specifically targets and binds to actin filaments, which play a crucial role in various cellular processes. It can be used for the isolation and detection of nucleic acids within the nucleus, making it an invaluable tool for researchers and scientists.</p>

<p>The SIRT5 antibody is a highly specialized protein that is used in various scientific research applications. It is commonly used in studies involving human serum, proteins, and cells such as MCF-7. This antibody can be utilized for a range of purposes including the detection and analysis of hormone peptides, glycoproteins, and tyrosine residues. Additionally, it has been proven to be effective in the identification and quantification of chemokines and other antibodies. The SIRT5 antibody also plays a crucial role in antibody-drug conjugate research as well as in the detection of specific markers like glucagon and alpha-fetoprotein. With its exceptional specificity and reliability, this monoclonal antibody is an indispensable tool for any researcher seeking accurate and precise results.</p>

<p>The CMKLR1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can be used for various applications, including antiviral research and growth factor studies. This antibody specifically targets CMKLR1, a receptor involved in immune responses and inflammation.</p>

<p>MAGT1 antibody was raised in Rabbit using Human MAGT1 as the immunogen</p>

<p>The GKN1 antibody is a highly specialized monoclonal antibody that targets erythropoietin, a growth factor involved in red blood cell production. This antibody specifically binds to the erythropoietin receptor and inhibits its activity, resulting in decreased erythropoietin signaling. By blocking this pathway, the GKN1 antibody can potentially regulate red blood cell production and viscosity levels in the body.</p>

<p>CD3 antibody (FITC) was raised in Mouse using a purified recombinant fragment of human CD3 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>Rabbit polyclonal OR9A2 antibody</p>

<p>PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD</p>

<p>Rabbit polyclonal UBA7 antibody</p>

<p>Rabbit polyclonal FOXN4 antibody</p>

<p>The BMP2 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of bone morphogenetic protein 2 (BMP2), a key regulator of various cellular processes. This antibody specifically binds to activated BMP2, preventing its interaction with cellular receptors and downstream signaling pathways.</p>

<p>The BID antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets specific chemokines and has been extensively studied in the field of Life Sciences. The BID antibody has shown great potential in various applications, including lysis assays, glycosylation studies, and as a tool for detecting specific proteins in research experiments. This monoclonal antibody has been used to study the role of epidermal growth factor (EGF) signaling pathway and its interaction with β-catenin and caspase-9. Additionally, it has been used as a diagnostic tool for detecting anti-dnp antibodies and as a therapeutic agent in the treatment of HER2-positive breast cancer alongside trastuzumab. With its high specificity and versatility, the BID antibody is an invaluable tool for researchers in various fields.</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>The WDFY3 antibody is a highly valuable product in the field of Life Sciences. It is a Polyclonal Antibody that plays a crucial role as a biomarker composition. This antibody specifically targets cation channels and interleukins, making it an essential tool for researchers studying these areas.</p>

<p>ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR</p>

<p>CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL</p>

<p>Rabbit polyclonal MNK1 antibody (Thr250)</p>

<p>Rabbit polyclonal SYT9 antibody</p>

<p>The cRel antibody is a powerful tool in the field of Life Sciences. It is an antiviral medicament that specifically targets the cRel molecule, a key player in various cellular processes. This antibody has been extensively tested and validated in human serum assays, where it has shown remarkable specificity and effectiveness.</p>

<p>Rat monoclonal Ly6G antibody (allophycocyanin)</p>

<p>RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL</p>

<p>TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST</p>

<p>Mouse monoclonal cJUN antibody</p>

<p>Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE</p>

<p>The Vinculin antibody is a low-molecular-weight growth factor that falls under the category of Life Sciences. It is a monoclonal antibody that has been specifically designed for immobilization purposes. This highly specialized antibody has the ability to bind with collagen and other binding proteins, making it an essential tool in various research applications. Additionally, the Vinculin antibody has shown neuroprotective properties and can neutralize vasoactive intestinal peptide (VIP), a hormone involved in regulating blood flow and immune responses. With its high affinity and specificity, this antibody can be used in experiments involving electrode-based techniques and interferon studies.</p>

<p>The NTRK3 antibody is a monoclonal antibody that is used in the field of Life Sciences. It is a powerful tool for researchers and scientists studying various aspects of biology, including antiviral mechanisms, blood plasma components, growth factors, and autoantibodies. The NTRK3 antibody can be used in various laboratory techniques such as particle chemiluminescence and magnetic particles to detect and analyze specific proteins or molecules of interest. Additionally, it has been shown to have an impact on microvessel density and syncytia formation. With its high specificity and affinity, this monoclonal antibody is an essential resource for researchers working with mesenchymal stem cells or investigating the role of antibodies in different biological processes.</p>

<p>Rabbit polyclonal GCDFP15 antibody</p>

<p>KI67 antibody was raised in Mouse using synthetic peptide corresponding to aa (CEDLAGFKELFQTPG) of human KI67, conjugated to KLH, as the immunogen.</p>

<p>Insulin beta chain antibody was raised in mouse using C-terminal pentapeptide of insulin b-chain as the immunogen.</p>

<p>The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.</p>