Anticuerpos primarios

<p>NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGSNGSKENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYT</p>

<p>The Gata4 antibody is a monoclonal antibody that specifically targets the Gata4 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and shown to be cytotoxic against cells expressing high levels of Gata4, making it a valuable tool for research and diagnostic applications. Additionally, the Gata4 antibody has been used in assays to study the interaction between Gata4 and other proteins, such as urokinase plasminogen activator. It has also been utilized in studies involving adipose tissue and its role in metabolism. This monoclonal antibody is highly specific and exhibits minimal cross-reactivity with other target molecules. With its exceptional binding affinity and selectivity, the Gata4 antibody is an essential tool for researchers studying various cellular processes and developing potential therapeutic inhibitors.</p>

<p>Rabbit polyclonal IGF1R antibody (Tyr1346)</p>

<p>Rabbit polyclonal VPS45 antibody</p>

<p>The Nav1.7 antibody is a monoclonal antibody that targets the Nav1.7 channel, a key player in pain signaling. This antibody has been extensively studied for its potential therapeutic applications in pain management. It works by blocking the activity of the Nav1.7 channel, which reduces the transmission of pain signals to the brain.</p>

<p>Rabbit polyclonal Collagen VI alpha 1 antibody</p>

<p>Rabbit polyclonal POLR2C antibody</p>

<p>Mouse monoclonal IL1b antibody (PE)</p>

<p>DHDH antibody was raised in Rabbit using Human DHDH as the immunogen</p>

<p>Rabbit polyclonal SKY antibody (Tyr749/681)</p>

<p>Mouse monoclonal FAHD2A antibody</p>

<p>The Fibronectin 1 antibody is a monoclonal antibody used in Life Sciences for various applications. It is commonly used as a diagnostic reagent to detect the presence of fibronectin 1, a biomolecule involved in cell adhesion and migration. This antibody specifically binds to fibronectin 1 with high affinity and specificity, making it an ideal tool for research and diagnostic purposes.</p>

<p>The HAT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of the HAT1 enzyme, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its efficacy in blocking HAT1 activity in nuclear and adipose tissues.</p>

<p>Purified Polyclonal Topoisomerase 2 alpha antibody</p>

<p>LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL</p>

<p>HSP60 antibody was raised in mouse using recombinant human Hsp60 (1-573aa) purified from E. coli as the immunogen.</p>

<p>FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF</p>

<p>Rabbit polyclonal TAS2R13 antibody</p>

<p>Rabbit polyclonal PRPH2 antibody</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>The ID2 antibody is a monoclonal antibody that has a high affinity for various proteins, including serum albumin, alpha-fetoprotein, collagen, fibronectin, and erythropoietin. This antibody is widely used in the field of Life Sciences for research purposes. It can be utilized to study protein-protein interactions, as well as to detect the presence of specific proteins in samples. The ID2 antibody has been shown to inhibit the growth of endothelial cells by blocking the activity of certain growth factors. It also plays a role in regulating the glycosylation process and interferon signaling pathways. This antibody is particularly useful in studies related to human serum, androgen metabolism, low-density lipoprotein metabolism, and cancer research. With its versatility and specificity, the ID2 antibody is an invaluable tool for researchers in various fields.</p>

<p>Rabbit polyclonal Tenascin antibody (biotin)</p>

<p>Rabbit Polyclonal Cofilin antibody (Ser3)</p>

<p>GST antibody was raised in mouse using recombinant Glutathione S transferase (GST) purified from E. coli as the immunogen.</p>

<p>The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.</p>

<p>RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY</p>

<p>MDM4 antibody was raised in Mouse using a purified recombinant fragment of human MDM4 expressed in E. coli as the immunogen.</p>

<p>TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI</p>

<p>NHP2 antibody was raised in Rabbit using Human NHP2 as the immunogen</p>

<p>The MIF antibody is a highly effective inhibitor that targets the polymers of macrophage migration inhibitory factor (MIF). This monoclonal antibody has neutralizing properties and is specifically designed to block the activity of MIF. It has been extensively used in Life Sciences research, particularly in studies related to annexin A2 and chemokine regulation. The MIF antibody can be used in various experimental techniques, including Western blotting, immunohistochemistry, and flow cytometry. Its high affinity for MIF makes it a valuable tool for researchers studying cardiomyocyte function and investigating the role of MIF in different biological processes. When combined with streptavidin or other detection systems, this monoclonal antibody provides reliable and accurate results. Choose the MIF antibody for your research needs and unlock new insights into the intricate mechanisms of cellular signaling pathways.</p>

<p>ALDH1A1 antibody was raised using the middle region of ALDH1A1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG</p>

<p>The RanGAP1 antibody is a highly specialized protein complex that plays a crucial role in various biological processes. It acts as a regulator for the transport of biomolecules between the nucleus and cytoplasm, ensuring proper cellular function. This antibody has been extensively studied for its potential therapeutic applications, particularly in the field of oncology.</p>

<p>Purified Rabbit polyclonal POLG2 antibody</p>

<p>CD69 antibody was raised in Rabbit using Human CD69 as the immunogen</p>

<p>The VCP antibody is an inhibitory factor that targets insulin and other growth factors. This acidic antibody has been shown to inhibit the activity of insulin and epidermal growth factor, preventing their binding to their respective receptors. Additionally, the VCP antibody has cytotoxic effects on cells expressing collagen and fibronectin, making it a potential therapeutic option for diseases involving excessive collagen production. This monoclonal antibody is widely used in Life Sciences research and has also been studied as a potential treatment for autoimmune disorders due to its ability to target autoantibodies. The VCP antibody shows promise in combination with other antibodies such as trastuzumab, an anti-HER2 antibody, in inhibiting tumor growth by blocking growth factor signaling pathways.</p>

<p>DAP3 antibody was raised in Rabbit using Human DAP3 as the immunogen</p>

<p>CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP</p>

<p>The AKT1 antibody is a cholinergic monoclonal antibody that targets the AKT1 protein. It plays a crucial role in various cellular processes, including cell survival, growth, and proliferation. This antibody specifically binds to the AKT1 protein, inhibiting its function and preventing downstream signaling pathways.</p>

<p>Rabbit polyclonal PPP2R2C antibody</p>

<p>Rabbit polyclonal XPF antibody</p>

<p>H2AFX antibody was raised using the N terminal of H2AFX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY</p>

<p>Rabbit polyclonal ATF2 antibody (Ser62or44)</p>

<p>CD147 antibody was raised in mouse using human T cell line Molt 13 as the immunogen.</p>

<p>Purified Rabbit polyclonal RACK1A antibody</p>

<p>RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER</p>

<p>The ATR antibody is a polyclonal antibody that is commonly used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and epinephrine, two important hormones involved in cell growth and signaling pathways. This antibody has been shown to have neutralizing effects on EGF-like inhibitory factors, which can block the activity of EGF and other growth factors. Additionally, the ATR antibody can also bind to albumin and serum albumin, two proteins commonly found in human serum. This makes it a valuable tool for studying protein-protein interactions and identifying potential therapeutic targets. Whether you're conducting research or developing new treatments, the ATR antibody is an essential tool for any scientist in the field of Life Sciences.</p>

<p>ACAT2 antibody was raised in Rabbit using Human ACAT2 as the immunogen</p>

<p>Rabbit polyclonal PKNOX2 antibody</p>

<p>The ERK1/2 antibody is a highly specialized monoclonal antibody that targets the nuclear region of cells. It is designed to detect and bind to specific proteins involved in the ERK1/2 signaling pathway, which plays a crucial role in various cellular processes such as cell proliferation, differentiation, and survival.</p>

<p>KIF3C antibody was raised in Rabbit using Human KIF3C as the immunogen</p>