Anticuerpos primarios

<p>Affinity purified Rabbit polyclonal TOM1L1 antibody</p>

<p>GAS8 antibody was raised using the middle region of GAS8 corresponding to a region with amino acids RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK</p>

<p>Rabbit Polyclonal GSK3 alpha antibody (Ser21)</p>

<p>SLC25A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ</p>

<p>NFX1 antibody was raised in Rabbit using Human NFX1 as the immunogen</p>

<p>APOA4 antibody was raised in Rabbit using Human APOA4 as the immunogen</p>

<p>The NRP1 antibody is a reactive antigen-binding molecule that specifically targets TNF-α. It is a monoclonal antibody that has cytotoxic properties and has been extensively used in the field of Life Sciences. This antibody can bind to human serum and has shown promising results in various studies. The NRP1 antibody is highly specific and can be used for research purposes, particularly in the areas of transmembrane conductance, interleukin-6, growth factors, and human chemokines. It is available both as a monoclonal antibody and as polyclonal antibodies. With its ability to target specific molecules, the NRP1 antibody opens up new possibilities for understanding and studying various biological processes.</p>

<p>Rabbit polyclonal DYR1A antibody</p>

<p>Affinity purified Rabbit polyclonal RFC1 antibody</p>

<p>Rabbit polyclonal PLA2G4E antibody</p>

<p>CLEC1A antibody was raised in Rabbit using Human CLEC1A as the immunogen</p>

<p>Rabbit Polyclonal Histone H3.1 antibody (Thr3)</p>

<p>The NMDAR1 antibody is a monoclonal antibody that specifically targets the NMDA receptor subtype 1. This receptor plays a crucial role in synaptic plasticity and is involved in various physiological and pathological processes. The NMDAR1 antibody has been extensively studied in the field of neuroscience and has shown great potential for research applications.</p>

<p>CES2 antibody was raised in Rabbit using Human CES2 as the immunogen</p>

<p>The VDAC1 antibody is a highly specialized monoclonal antibody that specifically targets the plasminogen receptor, histidine. This neutralizing antibody has been extensively studied and proven to effectively inhibit the binding of plasminogen to its receptor, thereby preventing the activation of plasminogen into plasmin. By blocking this crucial step in the plasminogen activation cascade, the VDAC1 antibody has shown great potential in various therapeutic applications.</p>

<p>The Collagen 2 antibody is a highly specific monoclonal antibody that targets collagen, an essential protein found in connective tissues. This antibody is derived from human serum and has been extensively studied in the field of Life Sciences. It has shown to be effective in detecting collagen in various research applications.</p>

<p>Purified Polyclonal CARD6 antibody</p>

<p>TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED</p>

<p>ADH1A antibody was raised using a synthetic peptide corresponding to a region with amino acids NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA</p>

<p>Staphylococcus Aureus ssaA1 antigen Monoclonal Antibody</p>

<p>Rabbit polyclonal CEB alpha antibody (Ser21)</p>

<p>Rabbit polyclonal RPH3A antibody</p>

<p>Affinity purified Rabbit polyclonal Cofilin 2 antibody</p>

<p>ACOX3 antibody was raised in rabbit using the C terminal of ACOX3 as the immunogen</p>

<p>Sigma 54 Monoclonal Antibody</p>

<p>Rabbit polyclonal NPEPL1 antibody</p>

<p>TMEM139 antibody was raised using the N terminal of TMEM139 corresponding to a region with amino acids ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN</p>

<p>Rabbit polyclonal PMM1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, it shows great promise in combating Mycobacterium tuberculosis strains. With its ability to specifically bind to markers expressed at high levels in these strains and inhibit cell growth in culture, this drug offers new hope in the fight against tuberculosis.</p>

<p>NSUN5C antibody was raised using the middle region of NSUN5C corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA</p>

<p>PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids  KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL</p>

<p>LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL</p>

<p>Affinity purified Mouse polyclonal APEX1 antibody</p>

<p>KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS</p>

<p>Affinity purified Rabbit polyclonal PKA alpha antibody</p>

<p>Affinity purified Rabbit polyclonal HSD3a antibody</p>

<p>CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA</p>

<p>Affinity purified Rabbit polyclonal FBXL3 antibody</p>

<p>PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH</p>

<p>AMN1 antibody was raised in Rabbit using Human AMN1 as the immunogen</p>

<p>CYCS antibody was raised in Rabbit using Human CYCS as the immunogen</p>

<p>HSD3B7 antibody was raised using the middle region of HSD3B7 corresponding to a region with amino acids QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR</p>

<p>Rabbit polyclonal AN30A antibody</p>

<p>CHML antibody was raised in rabbit using the N terminal of CHML as the immunogen</p>

<p>PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE</p>

<p>Rabbit polyclonal TRP antibody (biotin)</p>

<p>IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a multifunctional cytokine involved in various biological processes. IL-6 acts as both a pro-inflammatory and anti-inflammatory mediator, playing a crucial role in immune response regulation. The IL6 antibody binds to IL-6 and neutralizes its activity, preventing it from binding to its receptors and initiating downstream signaling pathways.</p>

<p>Affinity purified Rabbit polyclonal Tropomyosin 2 antibody</p>

<p>PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA</p>

<p>C3ORF19 antibody was raised using the middle region of C3Orf19 corresponding to a region with amino acids RQQWEEEEREALKRPMGPVHYEDIRENEARQLGVGYFAFARDKELRNKQM</p>